14 3 3 eta (YWHAH) (NM_003405) Human Mass Spec Standard

SKU PH300013

YWHAH MS Standard C13 and N15-labeled recombinant protein (NP_003396)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200013]
• Predicted MW: 28.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC200013 protein sequence; Red=Cloning site Green=Tags(s); ; MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKT; MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASG; EKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDT; LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003396
• RefSeq Size: 1807
• RefSeq ORF: 738
• Synonyms: YWHA1
• Locus ID: 7533
• UniProt ID: Q04917
• Cytogenetics: 22q12.3
• Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq, Jun 2009]
• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis