OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

14 3 3 eta (YWHAH) (NM_003405) Human Mass Spec Standard

Be the first to review this product
SKU
PH300013
YWHAH MS Standard C13 and N15-labeled recombinant protein (NP_003396)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA368725 YWHAH rabbit polyclonal antibody
100 ul
$310.00
LY418678 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH) (as WB positive control) 100 ug
$436.00

Other products for "14 3 3 eta or NM_003405"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200013
Predicted MW 28.2 kDa
Protein Sequence
Protein Sequence
>RC200013 protein sequence
Red=Cloning site Green=Tags(s)

MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKT
MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASG
EKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDT
LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003396
RefSeq Size 1807
RefSeq ORF 738
Synonyms YWHA1
Locus ID 7533
UniProt ID Q04917
Cytogenetics 22q12.3
Summary This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. provided by RefSeq, Jun 2009
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "14 3 3 eta" proteins (3)
SKU Description Size Price
LC418678 Lyophilized YWHAH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418678 Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH) (as WB positive control) 100 ug
$436.00
TP300013 Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products