SNRNP25 (NM_024571) Human Mass Spec Standard

SKU
PH300010
SNRNP25 MS Standard C13 and N15-labeled recombinant protein (NP_078847)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200010]
Predicted MW 15.3 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC200010
Blue=ORF Red=Cloning site Green=Tag(s)

MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKA
IQRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK

myc-FLAG tag

Recombinant protein using RC200010 also available, TP300010
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_078847
RefSeq Size 1103
RefSeq ORF 396
Synonyms C16orf33
Locus ID 79622
UniProt ID Q9BV90
Cytogenetics 16p13.3
Summary Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 25K protein that is a component of the U12-type spliceosome. [provided by RefSeq, Apr 2010]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:SNRNP25 (NM_024571) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411237 SNRNP25 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411237 Transient overexpression lysate of small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25) 100 ug
$436.00
TP300010 Recombinant protein of human small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.