Rbm8a (NM_001271138) Rat Tagged ORF Clone

CAT#: RR215957

  • TrueORF®

Rbm8a (myc-DDK-tagged) - Rat RNA binding motif protein 8A (Rbm8a)


  "NM_001271138" in other vectors (1)

Reconstitution Protocol

USD 330.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-Rbm8a Antibody
    • 100 ul

USD 539.00

Other products for "Rbm8a"

Specifications

Product Data
Type Rat Tagged ORF Clone
Tag Myc-DDK
Symbol Rbm8a
Synonyms Rbm8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RR215957 representing NM_001271138
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGTGCTGGATCTTCACGAGGCCGGGGGCGAGGATTTCGCCATGGATGAGGATGGTGACGAAA
GCATCCACAAACTAAAAGAAAAAGCGAAGAAACGGAAGGGCCGCGGTTTTGGTTCTGAAGAGGGGTCCCG
AGCGCGGATGCGGGAAGATTATGACAGTGTGGAGCAGGATGGCGATGAACCTGGACCACAGCGCTCTGTT
GAAGGTTGGATTCTCTTTGTCACTGGAGTCCACGAAGAAGCCACTGAAGAAGATATCCATGACAAGTTCG
CTGAATATGGGGAAATAAAAAATATCCACCTGAATTTGGACAGGCGCACGGGATACTTGAAGGGGTATAC
TCTAGTTGAGTATGAAACATACAAAGAAGCTCAGGCTGCCATGGAGGGACTAAATGGTCAAGATTTGATG
GGACAGCCAATCAGTGTTGACTGGTGTTTTGTTCGTGGTCCACCAAAGGGCAAGAGGAGAGGTGGCCGAA
GACGAAGCAGGAGTCCAGACCGAAGACGCCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RR215957 representing NM_001271138
Red=Cloning site Green=Tags(s)

MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSV
EGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLM
GQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001271138
ORF Size 522 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001271138.1, NP_001258067.1
RefSeq Size 1486 bp
RefSeq ORF 525 bp
Locus ID 295284
UniProt ID Q27W01
Cytogenetics 2q34
MW 19.9 kDa
Gene Summary Required for pre-mRNA splicing as component of the spliceosome (By similarity). Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Its removal from cytoplasmic mRNAs requires translation initiation from EJC-bearing spliced mRNAs. Associates preferentially with mRNAs produced by splicing. Does not interact with pre-mRNAs, introns, or mRNAs produced from intronless cDNAs. Associates with both nuclear mRNAs and newly exported cytoplasmic mRNAs (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.