Drd1 (NM_012546) Rat Tagged ORF Clone

CAT#: RR202421

Drd1 (Myc-DDK-tagged ORF) - Rat dopamine receptor D1A (Drd1a), (10 ug)

Change vector?

  • TrueORF®

USD 567


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Drd1 (NM_012546) Rat Tagged ORF Clone
Symbol Drd1
Synonyms D1a; Drd-1; Drd1a
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RR202421 representing NM_012546
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCCTAACACTTCTACCATGGATGAGGCCGGGCTGCCAGCGGAGAGGGATTTCTCCTTTCGCATCC
TCACGGCCTGTTTCCTGTCACTGCTCATCCTGTCCACTCTCCTGGGCAATACCCTTGTCTGTGCGGCCGT
CATCCGGTTTCGACACCTGAGGTCCAAGGTGACCAACTTCTTTGTCATCTCTTTAGCTGTGTCAGATCTC
TTGGTGGCTGTCCTGGTCATGCCCTGGAAAGCTGTGGCCGAGATTGCTGGCTTTTGGCCTTTGGGTCCCT
TTTGTAACATCTGGGTAGCCTTTGACATCATGTGCTCTACGGCGTCCATTCTGAACCTCTGCGTGATCAG
CGTGGACAGGTACTGGGCTATCTCCAGCCCTTTCCAGTATGAGAGGAAGATGACCCCCAAAGCAGCCTTC
ATCCTGATTAGCGTAGCATGGACTCTGTCTGTCCTTATATCCTTCATCCCAGTACAGCTAAGCTGGCACA
AGGCAAAGCCCACATGGCCCTTGGATGGCAATTTTACCTCCCTGGAGGACACCGAGGATGACAACTGTGA
CACAAGGTTGAGCAGGACGTATGCCATTTCATCGTCCCTCATCAGCTTTTACATCCCCGTAGCCATTATG
ATCGTCACCTACACCAGTATCTACAGGATTGCCCAGAAGCAAATCCGGCGCATCTCAGCCTTGGAGAGGG
CAGCAGTCCATGCCAAGAATTGCCAGACCACCGCAGGTAACGGGAACCCCGTCGAATGCGCCCAGTCTGA
AAGTTCCTTTAAGATGTCCTTCAAGAGGGAGACGAAAGTTCTAAAGACGCTGTCTGTGATCATGGGGGTG
TTTGTGTGCTGCTGGCTCCCTTTCTTCATCTCGAACTGTATGGTGCCCTTCTGTGGCTCTGAGGAGACCC
AGCCATTCTGCATCGATTCCATCACCTTCGATGTGTTTGTGTGGTTTGGGTGGGCGAATTCTTCCCTGAA
CCCCATTATTTATGCTTTTAATGCTGACTTCCAGAAGGCGTTCTCAACCCTCTTAGGATGCTACAGACTC
TGCCCTACTACGAATAATGCCATAGAGACGGTGAGCATTAACAACAATGGGGCTGTGGTGTTTTCCAGCC
ACCATGAGCCCCGAGGCTCCATCTCCAAGGACTGTAATCTGGTTTACCTGATCCCTCATGCCGTGGGCTC
CTCTGAGGACCTGAAGAAGGAAGAGGCTGGTGGAATAGCTAAGCCACTGGAGAAGCTGTCCCCAGCCTTA
TCGGTCATATTGGACTATGACACCGATGTCTCTCTAGAAAAGATCCAACCTGTCACACACAGTGGACAGC
ATTCCACTATTCCACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RR202421 representing NM_012546
Red=Cloning site Green=Tags(s)

MAPNTSTMDEAGLPAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDL
LVAVLVMPWKAVAEIAGFWPLGPFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFQYERKMTPKAAF
ILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLEDTEDDNCDTRLSRTYAISSSLISFYIPVAIM
IVTYTSIYRIAQKQIRRISALERAAVHAKNCQTTAGNGNPVECAQSESSFKMSFKRETKVLKTLSVIMGV
FVCCWLPFFISNCMVPFCGSEETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFQKAFSTLLGCYRL
CPTTNNAIETVSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIAKPLEKLSPAL
SVILDYDTDVSLEKIQPVTHSGQHSTIP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012546
ORF Size 1346 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012546.1, NM_012546.2, NM_012546.3, NP_036678
RefSeq Size 2236
RefSeq ORF 1341
Locus ID 24316
Cytogenetics 17p14
MW 49.9 kDa
Gene Summary induces dopamine sensitive adenylate cyclase activation; plays a role in regulating food intake [RGD, Feb 2006]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. COMPLETENESS: complete on the 3' end.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations