p53 AIP1 (TP53AIP1) (NM_001195195) Human Tagged ORF Clone

SKU
RG230930
TP53AIP1 (tGFP-tagged) - Human tumor protein p53 regulated apoptosis inducing protein 1 (TP53AIP1), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$365.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol p53 AIP1
Synonyms P53AIP1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG230930 representing NM_001195195
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGATCTTCCTCTGAGGCGAGCTTCAGATCTGCTCAAGCTTCCTGCAGTGGGGCCAGGAGGCAGGGCC
TGGGCAGGGGAGACCAGAACCTCTCGGTGATGCCTCCGAATGGCAGGGCTCAGACACACACACCTGGCTG
GGTTTCAGATCCCTTAGTTTTGGGTGCCCAAGTTCACGGAGGGTGCCGGGGAATAGAAGCTCTGTCAGTC
TCGTCTGGATCTTGGTCCTCAGCAACTGTCTGGATCCTGACAGTGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG230930 representing NM_001195195
Red=Cloning site Green=Tags(s)

MGSSSEASFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSDPLVLGAQVHGGCRGIEALSV
SSGSWSSATVWILTVQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001195195
ORF Size 258 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001195195.1, NP_001182124.1
RefSeq Size 1255 bp
RefSeq ORF 261 bp
Locus ID 63970
UniProt ID Q9HCN2
Cytogenetics 11q24.3
Protein Families Druggable Genome
Protein Pathways p53 signaling pathway
Summary This gene is specifically expressed in the thymus, and encodes a protein that is localized to the mitochondrion. The expression of this gene is inducible by p53, and it is thought to play an important role in mediating p53-dependent apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Oct 2011]
Write Your Own Review
You're reviewing:p53 AIP1 (TP53AIP1) (NM_001195195) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC230930 TP53AIP1 (Myc-DDK-tagged)-Human tumor protein p53 regulated apoptosis inducing protein 1 (TP53AIP1), transcript variant 2 10 ug
$165.00
RC230930L3 Lenti-ORF clone of TP53AIP1 (Myc-DDK-tagged)-Human tumor protein p53 regulated apoptosis inducing protein 1 (TP53AIP1), transcript variant 2 10 ug
$465.00
RC230930L4 Lenti-ORF clone of TP53AIP1 (mGFP-tagged)-Human tumor protein p53 regulated apoptosis inducing protein 1 (TP53AIP1), transcript variant 2 10 ug
$465.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.