MGMT (NM_002412) Human Tagged ORF Clone

SKU
RG229131
MGMT (tGFP-tagged) - Human O-6-methylguanine-DNA methyltransferase (MGMT)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MGMT
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG229131 representing NM_002412
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGGACAGCCCGCGCCCCTAGAACGCTTTGCGTCCCGACGCCCGCAGGTCCTCGCGGTGCGCACCG
TTTGCGACTTGGTACTTGGAAAAATGGACAAGGATTGTGAAATGAAACGCACCACACTGGACAGCCCTTT
GGGGAAGCTGGAGCTGTCTGGTTGTGAGCAGGGTCTGCACGAAATAAAGCTCCTGGGCAAGGGGACGTCT
GCAGCTGATGCCGTGGAGGTCCCAGCCCCCGCTGCGGTTCTCGGAGGTCCGGAGCCCCTGATGCAGTGCA
CAGCCTGGCTGAATGCCTATTTCCACCAGCCCGAGGCTATCGAAGAGTTCCCCGTGCCGGCTCTTCACCA
TCCCGTTTTCCAGCAAGAGTCGTTCACCAGACAGGTGTTATGGAAGCTGCTGAAGGTTGTGAAATTCGGA
GAAGTGATTTCTTACCAGCAATTAGCAGCCCTGGCAGGCAACCCCAAAGCCGCGCGAGCAGTGGGAGGAG
CAATGAGAGGCAATCCTGTCCCCATCCTCATCCCGTGCCACAGAGTGGTCTGCAGCAGCGGAGCCGTGGG
CAACTACTCCGGAGGACTGGCCGTGAAGGAATGGCTTCTGGCCCATGAAGGCCACCGGTTGGGGAAGCCA
GGCTTGGGAGGGAGCTCAGGTCTGGCAGGGGCCTGGCTCAAGGGAGCGGGAGCTACCTCGGGCTCCCCGC
CTGCTGGCCGAAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG229131 representing NM_002412
Red=Cloning site Green=Tags(s)

MLGQPAPLERFASRRPQVLAVRTVCDLVLGKMDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTS
AADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFG
EVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKP
GLGGSSGLAGAWLKGAGATSGSPPAGRN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002412
ORF Size 714 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002412.4
RefSeq Size 1265 bp
RefSeq ORF 624 bp
Locus ID 4255
UniProt ID P16455
Cytogenetics 10q26.3
Domains Methyltransf_1
Protein Families Druggable Genome
Summary Alkylating agents are potent carcinogens that can result in cell death, mutation and cancer. The protein encoded by this gene is a DNA repair protein that is involved in cellular defense against mutagenesis and toxicity from alkylating agents. The protein catalyzes transfer of methyl groups from O(6)-alkylguanine and other methylated moieties of the DNA to its own molecule, which repairs the toxic lesions. Methylation of the genes promoter has been associated with several cancer types, including colorectal cancer, lung cancer, lymphoma and glioblastoma. [provided by RefSeq, Sep 2015]
Write Your Own Review
You're reviewing:MGMT (NM_002412) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201612 MGMT (Myc-DDK-tagged)-Human O-6-methylguanine-DNA methyltransferase (MGMT) 10 ug
$450.00
RC201612L1 Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), Myc-DDK-tagged 10 ug
$750.00
RC201612L3 Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), Myc-DDK-tagged 10 ug
$750.00
RC229131 MGMT (Myc-DDK-tagged)-Human O-6-methylguanine-DNA methyltransferase (MGMT) 10 ug
$450.00
RC229131L1 Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), Myc-DDK-tagged 10 ug
$750.00
RC229131L2 Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), mGFP tagged 10 ug
$750.00
RC229131L3 Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), Myc-DDK-tagged 10 ug
$750.00
RC229131L4 Lenti ORF clone of Human O-6-methylguanine-DNA methyltransferase (MGMT), mGFP tagged 10 ug
$750.00
RG201612 MGMT (tGFP-tagged) - Human O-6-methylguanine-DNA methyltransferase (MGMT) 10 ug
$650.00
SC108494 MGMT (untagged)-Human O-6-methylguanine-DNA methyltransferase (MGMT) 10 ug
$450.00
SC322190 MGMT (untagged)-Human O-6-methylguanine-DNA methyltransferase (MGMT) 10 ug
$450.00
SC327766 MGMT (untagged)-Human O-6-methylguanine-DNA methyltransferase (MGMT) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.