SINHCAF (NM_001135811) Human Tagged ORF Clone

SKU
RG227909
FAM60A (tGFP-tagged) - Human family with sequence similarity 60, member A (FAM60A), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SINHCAF
Synonyms C12orf14; FAM60A; L4; TERA
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG227909 representing NM_001135811
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGGTTTTCACAAGCCAAAGATGTACCGAAGTATAGAGGGCTGCTGTATTTGCAGAGCTAAGTCCT
CCAGTTCTCGATTCACTGACAGTAAACGCTATGAAAAGGACTTCCAGAGCTGTTTTGGATTGCATGAGAC
TCGTTCAGGAGACATCTGCAATGCCTGTGTCCTGCTTGTGAAAAGATGGAAGAAGTTGCCAGCAGGATCA
AAAAAAAACTGGAATCATGTGGTAGATGCAAGGGCTGGACCCAGTCTAAAGACTACATTGAAACCAAAGA
AAGTGAAAACTCTATCTGGGAACAGGATAAAAAGCAACCAGATCAGTAAACTGCAGAAGGAATTTAAACG
TCATAATTCTGATGCTCACAGTACCACCTCAAGTGCCTCCCCAGCTCAATCTCCTTGTTACAGTAACCAG
TCAGATGACGGCTCAGATACAGAGATGGCTTCTGGTTCTAACAGAACACCAGTTTTTTCCTTTTTAGATC
TCACTTACTGGAAAAGACAGAAGATATGTTGTGGGATCATCTATAAAGGCCGTTTTGGGGAAGTCCTCAT
TGACACACATCTCTTCAAGCCTTGCTGCAGCAATAAGAAAGCAGCTGCTGAGAAGCCAGAGGAGCAGGGG
CCAGAGCCTCTGCCCATCTCCACTCAGGAGTGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG227909 representing NM_001135811
Red=Cloning site Green=Tags(s)

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGS
KKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQ
SDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQG
PEPLPISTQEW

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001135811
ORF Size 663 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001135811.1, NP_001129283.1
RefSeq Size 3134 bp
RefSeq ORF 666 bp
Locus ID 58516
UniProt ID Q9NP50
Cytogenetics 12p11.21
Summary Subunit of the Sin3 deacetylase complex (Sin3/HDAC), this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway (PubMed:22865885, PubMed:22984288). Core component of a SIN3A complex (composed of at least SINHCAF, SIN3A, HDAC1, SAP30, RBBP4, OGT and TET1) present in embryonic stem (ES) cells. Promotes the stability of SIN3A and its presence on chromatin and is essential for maintaining the potential of ES cells to proliferate rapidly, while ensuring a short G1-phase of the cell cycle, thereby preventing premature lineage priming (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SINHCAF (NM_001135811) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC227909 FAM60A (Myc-DDK-tagged)-Human family with sequence similarity 60, member A (FAM60A), transcript variant 1 10 ug
$300.00
RC227909L1 Lenti ORF clone of Human family with sequence similarity 60, member A (FAM60A), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC227909L2 Lenti ORF clone of Human family with sequence similarity 60, member A (FAM60A), transcript variant 1, mGFP tagged 10 ug
$600.00
RC227909L3 Lenti ORF clone of Human family with sequence similarity 60, member A (FAM60A), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC227909L4 Lenti ORF clone of Human family with sequence similarity 60, member A (FAM60A), transcript variant 1, mGFP tagged 10 ug
$600.00
SC324799 FAM60A (untagged)-Human family with sequence similarity 60, member A (FAM60A), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.