P311 (NREP) (NM_001142479) Human Tagged ORF Clone

SKU
RG227842
NREP (tGFP-tagged) - Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 7
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol P311
Synonyms C5orf13; D4S114; P311; PRO1873; PTZ17; SEZ17
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG227842 representing NM_001142479
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTTTATTACCCAGAACTCTTTGTCTGGGTCAGTCAAGAACCATTTCCAAACAAGGACATGGAGGGAA
GGCTTCCTAAGGGAAGACTTCCTGTCCCAAAGGAAGTGAACCGCAAGAAGAACGATGAGACAAACGCTGC
CTCCCTGACTCCACTGGGCAGCAGTGAACTCCGCTCCCCAAGAATCAGTTACCTCCACTTTTTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG227842 representing NM_001142479
Red=Cloning site Green=Tags(s)

MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001142479
ORF Size 204 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001142479.1, NP_001135951.1
RefSeq Size 2105 bp
RefSeq ORF 207 bp
Locus ID 9315
UniProt ID Q16612
Cytogenetics 5q22.1
Summary May have roles in neural function. Ectopic expression augments motility of gliomas. Promotes also axonal regeneration (By similarity). May also have functions in cellular differentiation (By similarity). Induces differentiation of fibroblast into myofibroblast and myofibroblast ameboid migration. Increases retinoic-acid regulation of lipid-droplet biogenesis (By similarity). Down-regulates the expression of TGFB1 and TGFB2 but not of TGFB3 (By similarity). May play a role in the regulation of alveolar generation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:P311 (NREP) (NM_001142479) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC227842 NREP (Myc-DDK-tagged)-Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 7 10 ug
$289.00
RC227842L3 Lenti-ORF clone of NREP (Myc-DDK-tagged)-Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 7 10 ug
$450.00
RC227842L4 Lenti-ORF clone of NREP (mGFP-tagged)-Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 7 10 ug
$450.00
SC324695 NREP (untagged)-Human chromosome 5 open reading frame 13 (C5orf13), transcript variant 7 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.