VSTM5 (NM_001144871) Human Tagged ORF Clone

SKU
RG227422
VSTM5 (tGFP-tagged) - Human chromosome 11 open reading frame 90 (C11orf90)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol VSTM5
Synonyms C11orf90
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG227422 representing NM_001144871
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGCCTCTGCCCAGCGGGAGGAGGAAGACCCGAGGCATCTCCCTAGGACTCTTCGCCCTCTGCCTGG
CCGCAGCCCGCTGTCTGCAGAGTCAGGGTGTGTCCCTATACATTCCTCAGGCCACCATCAATGCCACTGT
CAAAGAAGACATCCTGCTCTCAGTTGAGTACTCCTGTCATGGAGTGCCCACCATCGAATGGACATATTCA
TCCAATTGGGGAACGCAGAAGATCGTGGAGTGGAAACCAGGGACTCAGGCCAACATCTCTCAAAGCCACA
AGGACAGAGTCTGCACCTTTGACAACGGCTCCATCCAGCTCTTCAGCGTGGGAGTGAGGGATTCCGGCTA
CTATGTCATCACCGTGACGGAGCGCCTGGGGAGCAGCCAGTTTGGCACCATCGTGCTGCACGTCTCTGAG
ATCCTCTATGAAGACCTGCACTTTGTCGCTGTCATCCTTGCTTTTCTCGCTGCTGTGGCCGCAGTATTAA
TCAGCCTCATGTGGGTTTGTAATAAGTGTGCATATAAATTTCAGAGGAAGAGAAGACACAAACTCAAAGA
AAGCACAACTGAGGAGATTGAGCTGGAAGATGTTGAGTGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG227422 representing NM_001144871
Red=Cloning site Green=Tags(s)

MRPLPSGRRKTRGISLGLFALCLAAARCLQSQGVSLYIPQATINATVKEDILLSVEYSCHGVPTIEWTYS
SNWGTQKIVEWKPGTQANISQSHKDRVCTFDNGSIQLFSVGVRDSGYYVITVTERLGSSQFGTIVLHVSE
ILYEDLHFVAVILAFLAAVAAVLISLMWVCNKCAYKFQRKRRHKLKESTTEEIELEDVEC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001144871
ORF Size 600 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001144871.2
RefSeq Size 603 bp
RefSeq ORF 603 bp
Locus ID 387804
UniProt ID A8MXK1
Cytogenetics 11q21
Protein Families Transmembrane
Summary Cell adhesion-like membrane protein of the central nervous system (CNS) which modulates both the position and complexity of central neurons by altering their membrane morphology and dynamics. Involved in the formation of neuronal dendrites and protrusions including dendritic filopodia. In synaptogenesis, regulates synapse formation by altering dendritic spine morphology and actin distribution. Promotes formation of unstable neuronal spines such as thin and branched types. Regulates neuronal morphogenesis and migration during cortical development in the brain.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:VSTM5 (NM_001144871) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC227422 VSTM5 (Myc-DDK-tagged)-Human chromosome 11 open reading frame 90 (C11orf90) 10 ug
$450.00
RC227422L3 Lenti ORF clone of Human chromosome 11 open reading frame 90 (C11orf90), Myc-DDK-tagged 10 ug
$750.00
RC227422L4 Lenti ORF clone of Human chromosome 11 open reading frame 90 (C11orf90), mGFP tagged 10 ug
$750.00
SC325594 VSTM5 (untagged)-Human chromosome 11 open reading frame 90 (C11orf90) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.