NCR3 (NM_001145466) Human Tagged ORF Clone

SKU
RG227357
NCR3 (tGFP-tagged) - Human natural cytotoxicity triggering receptor 3 (NCR3), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NCR3
Synonyms 1C7; CD337; LY117; MALS; NKp30
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG227357 representing NM_001145466
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTGGATGCTGTTGCTCATCTTGATCATGGTCCATCCAGGATCCTGTGCTCTCTGGGTGTCCCAGC
CCCCTGAGATTCGTACCCTGGAAGGATCCTCTGCCTTCCTGCCCTGCTCCTTCAATGCCAGCCAAGGGAG
ACTGGCCATTGGCTCCGTCACGTGGTTCCGAGATGAGGTGGTTCCAGGGAAGGAGGTGAGGAATGGAACC
CCAGAGTTCAGGGGCCGCCTGGCCCCACTTGCTTCTTCCCGTTTCCTCCATGACCACCAGGCTGAGCTGC
ACATCCGGGACGTGCGAGGCCATGACGCCAGCATCTACGTGTGCAGAGTGGAGGTGCTGGGCCTTGGTGT
CGGGACAGGGAATGGGACTCGGCTGGTGGTGGAGAAAGAACATCCTCAGCTAGGGGCTGGTACAGTCCTC
CTCCTTCGGGCTGGATTCTATGCTGTCAGCTTTCTCTCTGTGGCCGTGGGCAGCACCGTCTATTACCAGG
GCAAATATGCCAAATCTACTCTCTCCGGATTCCCCCAACTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG227357 representing NM_001145466
Red=Cloning site Green=Tags(s)

MAWMLLLILIMVHPGSCALWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGT
PEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVL
LLRAGFYAVSFLSVAVGSTVYYQGKYAKSTLSGFPQL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001145466
ORF Size 531 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001145466.2
RefSeq Size 1109 bp
RefSeq ORF 534 bp
Locus ID 259197
UniProt ID O14931
Cytogenetics 6p21.33
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Protein Pathways Natural killer cell mediated cytotoxicity
Summary The protein encoded by this gene is a natural cytotoxicity receptor (NCR) that may aid NK cells in the lysis of tumor cells. The encoded protein interacts with CD3-zeta (CD247), a T-cell receptor. A single nucleotide polymorphism in the 5' untranslated region of this gene has been associated with mild malaria suceptibility. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, May 2010]
Write Your Own Review
You're reviewing:NCR3 (NM_001145466) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC227357 NCR3 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 3 (NCR3), transcript variant 2 10 ug
$289.00 MSRP $300.00 MSRP $300.00
RC227357L1 Lenti-ORF clone of NCR3 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 3 (NCR3), transcript variant 2 10 ug
$600.00
RC227357L2 Lenti-ORF clone of NCR3 (mGFP-tagged)-Human natural cytotoxicity triggering receptor 3 (NCR3), transcript variant 2 10 ug
$600.00
RC227357L3 Lenti-ORF clone of NCR3 (Myc-DDK-tagged)-Human natural cytotoxicity triggering receptor 3 (NCR3), transcript variant 2 10 ug
$600.00
RC227357L4 Lenti-ORF clone of NCR3 (mGFP-tagged)-Human natural cytotoxicity triggering receptor 3 (NCR3), transcript variant 2 10 ug
$600.00
SC326448 NCR3 (untagged)-Human natural cytotoxicity triggering receptor 3 (NCR3), transcript variant 2, mRNA 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.