Glutathione S Transferase kappa 1 (GSTK1) (NM_001143681) Human Tagged ORF Clone

SKU
RG226807
GSTK1 (tGFP-tagged) - Human glutathione S-transferase kappa 1 (GSTK1), nuclear gene encoding mitochondrial protein, transcript variant 4
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Glutathione S Transferase kappa 1
Synonyms GST; GST13; GST 13-13; GST13-13; GSTK1-1; hGSTK1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG226807 representing NM_001143681
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCCCCTGCCGCGCACCGTGGAGCTCTTCTATGACGTGCTGTCCCCCTACTCCTGGCTGGGCTTCG
AGATCCTGTGCCGGTATCAGAATATCTGGAACATCAACCTGCAGTTGCGGCCCAGCCTCATAACAGGGAT
CATGAAAGACAGTGGAAGTTTGTCTGCCATGCGTTTCCTCACCGCCGTGAACTTGGAGCATCCAGAGATG
CTGGAGAAAGCGTCCCGGGAGCTGTGGATGCGCGTCTGGTCAAGGAATGAAGACATCACCGAGCCGCAGA
GCATCCTGGCGGCTGCAGAGAAGGCTGGTATGTCTGCAGAACAAGCCCAGGGACTTCTGGAAAAGATCGC
AACGCCAAAGGTGAAGAACCAGCTCAAGGAGACCACTGAGGCAGCCTGCAGATACGGAGCCTTTGGGCTG
CCCATCACCGTGGCCCATGTGGATGGCCAAACCCACATGTTATTTGGCTCTGACCGGATGGAGCTGCTGG
CGCACCTGCTGGGAGAGAAGTGGATGGGCCCTATACCTCCAGCCGTGAATGCCAGACTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG226807 representing NM_001143681
Red=Cloning site Green=Tags(s)

MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGSLSAMRFLTAVNLEHPEM
LEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGL
PITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001143681
ORF Size 549 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001143681.1, NP_001137153.1
RefSeq Size 929 bp
RefSeq ORF 552 bp
Locus ID 373156
UniProt ID Q9Y2Q3
Cytogenetics 7q34
Protein Pathways Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450
Summary This gene encodes a member of the kappa class of the glutathione transferase superfamily of enzymes that function in cellular detoxification. The encoded protein is localized to the peroxisome and catalyzes the conjugation of glutathione to a wide range of hydrophobic substates facilitating the removal of these compounds from cells. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jan 2009]
Write Your Own Review
You're reviewing:Glutathione S Transferase kappa 1 (GSTK1) (NM_001143681) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC226807 GSTK1 (Myc-DDK-tagged)-Human glutathione S-transferase kappa 1 (GSTK1), nuclear gene encoding mitochondrial protein, transcript variant 4 10 ug
$300.00
RC226807L3 Lenti ORF clone of Human glutathione S-transferase kappa 1 (GSTK1), nuclear gene encoding mitochondrial protein, transcript variant 4, Myc-DDK-tagged 10 ug
$600.00
RC226807L4 Lenti ORF clone of Human glutathione S-transferase kappa 1 (GSTK1), nuclear gene encoding mitochondrial protein, transcript variant 4, mGFP tagged 10 ug
$600.00
SC325572 GSTK1 (untagged)-Human glutathione S-transferase kappa 1 (GSTK1), nuclear gene encoding mitochondrial protein, transcript variant 4 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.