RNF185 (NM_001135825) Human Tagged ORF Clone

SKU
RG226760
RNF185 (tGFP-tagged) - Human ring finger protein 185 (RNF185), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RNF185
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG226760 representing NM_001135825
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAAGCAAGGGGCCCTCGGCCTCTGCATCTCCTGAGAACTCCAGTGCAGGGGGGCCCAGTGGGAGCA
GCAATGGCGCTGGCGAGAGCGGAGGGCAGGACAGCACTTTCGAGTGCAACATCTGCTTGGACACAGCCAA
GGATGCCGTCATCAGCCTGTGTGGCCACCTCTTCTGTTGGCCGTGTTTACATCAGGGATTTCAAGGATTT
GGATTTGGAGATGGTGGCTTCCAGATGTCTTTTGGAATTGGGGCATTTCCCTTTGGGATATTTGCCACAG
CATTTAATATAAATGATGGGCGGCCTCCTCCAGCTGTCCCTGGGACACCCCAGTATGTGGACGAGCAGTT
CCTGTCACGCCTCTTCCTATTTGTGGCCCTGGTGATCATGTTCTGGCTCCTGATTGCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG226760 representing NM_001135825
Red=Cloning site Green=Tags(s)

MASKGPSASASPENSSAGGPSGSSNGAGESGGQDSTFECNICLDTAKDAVISLCGHLFCWPCLHQGFQGF
GFGDGGFQMSFGIGAFPFGIFATAFNINDGRPPPAVPGTPQYVDEQFLSRLFLFVALVIMFWLLIA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001135825
ORF Size 408 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001135825.2
RefSeq Size 3050 bp
RefSeq ORF 411 bp
Locus ID 91445
UniProt ID Q96GF1
Cytogenetics 22q12.2
Protein Families Druggable Genome, Transmembrane
Summary E3 ubiquitin-protein ligase that regulates selective mitochondrial autophagy by mediating 'Lys-63'-linked polyubiquitination of BNIP1 (PubMed:21931693). Acts in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway, which targets misfolded proteins that accumulate in the endoplasmic reticulum (ER) for ubiquitination and subsequent proteasome-mediated degradation (PubMed:27485036). Protects cells from ER stress-induced apoptosis (PubMed:27485036). Responsible for the cotranslational ubiquitination and degradation of CFTR in the ERAD pathway (PubMed:24019521). Preferentially associates with the E2 enzymes UBE2J1 and UBE2J2 (PubMed:24019521).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RNF185 (NM_001135825) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC226760 RNF185 (Myc-DDK-tagged)-Human ring finger protein 185 (RNF185), transcript variant 3 10 ug
$150.00
RC226760L3 Lenti ORF clone of Human ring finger protein 185 (RNF185), transcript variant 3, Myc-DDK-tagged 10 ug
$450.00
RC226760L4 Lenti ORF clone of Human ring finger protein 185 (RNF185), transcript variant 3, mGFP tagged 10 ug
$450.00
SC325502 RNF185 (untagged)-Human ring finger protein 185 (RNF185), transcript variant 3 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.