RWDD3 (NM_001128142) Human Tagged ORF Clone

SKU
RG225219
RWDD3 (tGFP-tagged) - Human RWD domain containing 3 (RWDD3), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RWDD3
Synonyms RSUME
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG225219 representing NM_001128142
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGAGCCTGTGCAGGAGGAGCTCTCGGTCCTGGCCGCGATTTTCTGCAGGCCCCACGAGTGGGAGG
TGCTGAGCCGCTCAGAGACAGATGGGACCGTGTTCAGAATTCACACAAAAGCTGAAGGATTTATGGATGC
GGATATACCTCTGGAATTGGTGTTCCATTTGCCAGTCAATTATCCTTCATGTCTACCTGGTATCTCGATT
AACTCTGAACAGTTGACCAGGGCCCAGTGTGTGACTGTGAAAGAGAATTTACTTGAGCAAGCAGAGAGCC
TTTTGTCGGAGCCTATGGTTCATGAGCTGGTTCTCTGGATTCAGCAGAATCTCAGGCATATCCTCAGCCA
ACCAGAAACTGGCAGTGGCAGTGAAAAGTGTACTTTTTCAACAAGCACGACCATGGATGATGGATTGTGG
ATAACTCTTTTGCATTTAGATCACATGAGAGCAAAGACTAAATATGTCAAAATTGTGGAGAAGTGGGCTT
CAGATTTAAGGCTGACAGGAAGACTGATGTTCATGGGTAAAATAATACTGATTTTACTACAGGGAGACAG
AAACAACCTCAAGGTGCCAAAAAGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG225219 representing NM_001128142
Red=Cloning site Green=Tags(s)

MAEPVQEELSVLAAIFCRPHEWEVLSRSETDGTVFRIHTKAEGFMDADIPLELVFHLPVNYPSCLPGISI
NSEQLTRAQCVTVKENLLEQAESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLW
ITLLHLDHMRAKTKYVKIVEKWASDLRLTGRLMFMGKIILILLQGDRNNLKVPKS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001128142
ORF Size 585 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001128142.1, NP_001121614.1
RefSeq Size 1151 bp
RefSeq ORF 588 bp
Locus ID 25950
UniProt ID Q9Y3V2
Cytogenetics 1p21.3
Summary Enhancer of SUMO conjugation. Via its interaction with UBE2I/UBC9, increases SUMO conjugation to proteins by promoting the binding of E1 and E2 enzymes, thioester linkage between SUMO and UBE2I/UBC9 and transfer of SUMO to specific target proteins which include HIF1A, PIAS, NFKBIA, NR3C1 and TOP1. Isoform 1 and isoform 2 positively regulate the NF-kappa-B signaling pathway by enhancing the sumoylation of NF-kappa-B inhibitor alpha (NFKBIA), promoting its stabilization which consequently leads to an increased inhibition of NF-kappa-B transcriptional activity. Isoform 1 and isoform 2 negatively regulate the hypoxia-inducible factor-1 alpha (HIF1A) signaling pathway by increasing the sumoylation of HIF1A, promoting its stabilization, transcriptional activity and the expression of its target gene VEGFA during hypoxia. Isoform 2 promotes the sumoylation and transcriptional activity of the glucocorticoid receptor NR3C1 and enhances the interaction of SUMO1 and NR3C1 with UBE2I/UBC9. Has no effect on ubiquitination.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RWDD3 (NM_001128142) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225219 RWDD3 (Myc-DDK-tagged)-Human RWD domain containing 3 (RWDD3), transcript variant 2 10 ug
$300.00
RC225219L3 Lenti ORF clone of Human RWD domain containing 3 (RWDD3), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC225219L4 Lenti ORF clone of Human RWD domain containing 3 (RWDD3), transcript variant 2, mGFP tagged 10 ug
$600.00
SC322884 RWDD3 (untagged)-Human RWD domain containing 3 (RWDD3), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.