CSRP3 (NM_001127656) Human Tagged ORF Clone

SKU
RG225217
CSRP3 (tGFP-tagged) - Human cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CSRP3
Synonyms CLP; CMD1M; CMH12; CRP3; LMO4; MLP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG225217 representing NM_001127656
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAAACTGGGGCGGAGGCGCAAAATGTGGAGCCTGTGAAAAGACCGTCTACCATGCAGAAGAAATCC
AGTGCAATGGAAGGAGTTTCCACAAGACGTGTTTCCACTGCATGGCCTGCAGGAAGGCTCTTGACAGCAC
GACAGTCGCGGCTCATGAGTCGGAGATCTACTGCAAGGTGTGCTATGGGCGCAGATATGGCCCCAAAGGG
ATCGGGTATGGACAAGGCGCTGGCTGTCTCAGCACAGACACGGGCGAGCATCTCGGCCTGCAGTTCCAAC
AGTCCCCAAAGCCGGCACGCTCAGTTACCACCAGCAACCCTTCCAAATTCACTGCGAAGTTTGGAGAGTC
CGAGAAGTGCCCTCGATGTGGCAAGTCAGTCTATGCTGCTGAGAAGGTTATGGGAGGTGGCAAGCCTTGG
CACAAGACCTGTTTCCGCTGTGCCATCTGTGGGAAGAGTCTGGAGTCCACAAATGTCACTGACAAAGATG
GGGAACTTTATTGCAAAGTTTGCTATGCCAAAAATTTTGGCCCCACGGGTATTGGGTTTGGAGGCCTTAC
ACAACAAGTGGAAAAGAAAGAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG225217 representing NM_001127656
Red=Cloning site Green=Tags(s)

MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKVCYGRRYGPKG
IGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYAAEKVMGGGKPW
HKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTGIGFGGLTQQVEKKE

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001127656
ORF Size 582 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001127656.1, NP_001121128.1
RefSeq Size 1286 bp
RefSeq ORF 584 bp
Locus ID 8048
Cytogenetics 11p15.1
Summary This gene encodes a member of the CSRP family of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this protein is found in a group of proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Mutations in this gene are thought to cause heritable forms of hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) in humans. Alternatively spliced transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CSRP3 (NM_001127656) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225217 CSRP3 (Myc-DDK-tagged)-Human cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2 10 ug
$300.00
RC225217L3 Lenti ORF clone of Human cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC225217L4 Lenti ORF clone of Human cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2, mGFP tagged 10 ug
$600.00
SC322883 CSRP3 (untagged)-Human cysteine and glycine-rich protein 3 (cardiac LIM protein) (CSRP3), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.