JDP2 (NM_001135047) Human Tagged ORF Clone

SKU
RG225156
JDP2 (tGFP-tagged) - Human Jun dimerization protein 2 (JDP2), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol JDP2
Synonyms JUNDM2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG225156 representing NM_001135047
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCCTGGGCAGATCCCGGACCCTTCGGTGACCACAGGCTCCCTGCCAGGGCTTGGCCCCCTGACCG
GGCTCCCCAGCTCGGCCCTGACTGTGGAGGAGCTGAAATACGCTGACATCCGCAACCTCGGGGCCATGAT
TGCACCCTTGCACTTCCTGGAGGTGAAACTGGGCAAGAGGCCCCAGCCCGTGAAAAGTGAGCTAGATGAG
GAAGAGGAGCGAAGGAAAAGGCGCCGGGAGAAGAACAAAGTCGCAGCAGCCCGATGCCGGAACAAGAAGA
AGGAGCGCACGGAGTTTCTGCAGCGGGAATCCGAGCGGCTGGAACTCATGAACGCAGAGCTGAAGACCCA
GATTGAGGAGCTGAAGCAGGAGCGGCAGCAGCTCATCCTGATGCTGAACCGACACCGCCCCACCTGCATC
GTCCGGACCGACAGTGTCAAGACCCCCGAGTCAGAAGGCAACCCACTGCTCGAGCAGCTCGAGAAGAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG225156 representing NM_001135047
Red=Cloning site Green=Tags(s)

MMPGQIPDPSVTTGSLPGLGPLTGLPSSALTVEELKYADIRNLGAMIAPLHFLEVKLGKRPQPVKSELDE
EEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRPTCI
VRTDSVKTPESEGNPLLEQLEKK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001135047
ORF Size 489 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001135047.2
RefSeq Size 3801 bp
RefSeq ORF 492 bp
Locus ID 122953
UniProt ID Q8WYK2
Cytogenetics 14q24.3
Protein Families Transcription Factors
Summary Component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Involved in a variety of transcriptional responses associated with AP-1 such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris. Can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN. May control transcription via direct regulation of the modification of histones and the assembly of chromatin.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:JDP2 (NM_001135047) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC225156 JDP2 (Myc-DDK-tagged)-Human Jun dimerization protein 2 (JDP2), transcript variant 2 10 ug
$150.00
RC225156L3 Lenti ORF clone of Human Jun dimerization protein 2 (JDP2), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC225156L4 Lenti ORF clone of Human Jun dimerization protein 2 (JDP2), transcript variant 2, mGFP tagged 10 ug
$450.00
SC324754 JDP2 (untagged)-Human Jun dimerization protein 2 (JDP2), transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.