UBE2S (NM_014501) Human Tagged ORF Clone

SKU
RG224851
UBE2S (tGFP-tagged) - Human ubiquitin-conjugating enzyme E2S (UBE2S)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UBE2S
Synonyms E2-EPF; E2EPF; EPF5
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG224851 representing NM_014501
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACTCCAACGTGGAGAACCTACCCCCGCACATCATCCGCCTGGTGTACAAGGAGGTGACGACACTGA
CCGCAGACCCACCCGATGGCATCAAGGTCTTTCCCAACGAGGAGGACCTCACCGACCTCCAGGTCACCAT
CGAGGGCCCTGAGGGGACCCCATATGCTGGAGGTCTGTTCCGCATGAAACTCCTGCTGGGGAAGGACTTC
CCTGCCTCCCCACCCAAGGGCTACTTCCTGACCAAGATCTTCCACCCGAACGTGGGCGCCAATGGCGAGA
TCTGCGTCAACGTGCTCAAGAGGGACTGGACGGCTGAGCTGGGCATCCGACACGTACTGCTGACCATCAA
GTGCCTGCTGATCCACCCTAACCCCGAGTCTGCACTCAACGAGGAGGCGGGCCGCCTGCTCTTGGAGAAC
TACGAGGAGTATGCGGCTCGGGCCCGTCTGCTCACAGAGATCCACGGGGGCGCCGGCGGGCCCAGCGGCA
GGGCCGAAGCCGGTCGGGCCCTGGCCAGTGGCACTGAAGCTTCCTCCACCGACCCTGGGGCCCCAGGGGG
CCCGGGAGGGGCTGAGGGTCCCATGGCCAAGAAGCATGCTGGCGAGCGCGATAAGAAGCTGGCGGCCAAG
AAAAAGACGGACAAGAAGCGGGCGCTGCGGGCGCTGCGGCGGCTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG224851 representing NM_014501
Red=Cloning site Green=Tags(s)

MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDF
PASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLEN
YEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAK
KKTDKKRALRALRRL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014501
ORF Size 675 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014501.1, NP_055316.1
RefSeq Size 890 bp
RefSeq ORF 669 bp
Locus ID 27338
UniProt ID Q16763
Cytogenetics 19q13.42
Domains UBCc
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis
Summary This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:UBE2S (NM_014501) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224851 UBE2S (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2S (UBE2S) 10 ug
$450.00
RC224851L1 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2S (UBE2S), Myc-DDK-tagged 10 ug
$750.00
RC224851L2 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2S (UBE2S), mGFP tagged 10 ug
$750.00
RC224851L3 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2S (UBE2S), Myc-DDK-tagged 10 ug
$750.00
RC224851L4 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2S (UBE2S), mGFP tagged 10 ug
$750.00
SC114991 UBE2S (untagged)-Human ubiquitin-conjugating enzyme E2S (UBE2S) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.