H2BC14 (NM_003521) Human Tagged ORF Clone

SKU
RG224252
HIST1H2BM (tGFP-tagged) - Human histone cluster 1, H2bm (HIST1H2BM)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol H2BC14
Synonyms dJ160A22.3; H2B/e; H2BFE; HIST1H2BM
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG224252 representing NM_003521
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGAACCAGTCAAATCTGCTCCAGTCCCTAAAAAAGGCTCCAAGAAGGCCATTAACAAGGCTCAGA
AGAAGGATGGAAAGAAGCGCAAACGCAGCCGCAAGGAGAGCTACTCTGTGTATGTGTACAAGGTGCTGAA
GCAGGTCCACCCCGACACCGGCATCTCTTCCAAGGCTATGGGAATCATGAACTCCTTCGTCAACGACATC
TTTGAGCGTATCGCCGGAGAAGCGTCACGCCTGGCGCATTACAACAAGCGCTCGACCATCACTTCGAGGG
AGATCCAGACGGCCGTGCGCCTACTGCTACCCGGGGAATTGGCCAAGCACGCCGTGTCCGAGGGCACCAA
GGCCGTCACCAAGTATACCAGCTCCAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG224252 representing NM_003521
Red=Cloning site Green=Tags(s)

MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003521
ORF Size 378 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003521.2, NP_003512.1
RefSeq Size 446 bp
RefSeq ORF 381 bp
Locus ID 8342
UniProt ID Q99879
Cytogenetics 6p22.1
Protein Pathways Systemic lupus erythematosus
Summary Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2B family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3. [provided by RefSeq, Aug 2015]
Write Your Own Review
You're reviewing:H2BC14 (NM_003521) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC224252 HIST1H2BM (Myc-DDK-tagged)-Human histone cluster 1, H2bm (HIST1H2BM) 10 ug
$150.00
RC224252L1 Lenti ORF clone of Human histone cluster 1, H2bm (HIST1H2BM), Myc-DDK-tagged 10 ug
$450.00
RC224252L2 Lenti ORF clone of Human histone cluster 1, H2bm (HIST1H2BM), mGFP tagged 10 ug
$450.00
RC224252L3 Lenti ORF clone of Human histone cluster 1, H2bm (HIST1H2BM), Myc-DDK-tagged 10 ug
$450.00
RC224252L4 Lenti ORF clone of Human histone cluster 1, H2bm (HIST1H2BM), mGFP tagged 10 ug
$450.00
SC309005 HIST1H2BM (untagged)-Human histone cluster 1, H2bm (HIST1H2BM) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.