LY6G6D (NM_021246) Human Tagged ORF Clone

SKU
RG223536
LY6G6D (tGFP-tagged) - Human lymphocyte antigen 6 complex, locus G6D (LY6G6D)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol LY6G6D
Synonyms C6orf23; G6D; LY6-D; MEGT1; NG25
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG223536 representing NM_021246
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAACCCCAGTTTGTTGGGATCTTGCTCAGCTCCCTGCTAGGGGCTGCCTTGGGAAACCGAATGCGGT
GCTACAACTGTGGTGGAAGCCCCAGCAGTTCTTGCAAAGAGGCCGTGACCACCTGTGGCGAGGGCAGACC
CCAGCCAGGCCTGGAACAGATCAAGCTACCTGGAAACCCCCCAGTGACCTTGATTCACCAACATCCAGCC
TGCGTCGCAGCCCATCATTGCAATCAAGTGGAGACAGAGTCGGTGGGAGACGTGACTTATCCAGCCCACA
GGGACTGCTACCTGGGAGACCTGTGCAACAGCGCCGTGGCAAGCCATGTGGCCCCTGCAGGCATTTTGGC
TGCAGCAGCTACCGCCCTGACCTGTCTCTTGCCAGGACTGTGGAGCGGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG223536 representing NM_021246
Red=Cloning site Green=Tags(s)

MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPA
CVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021246
ORF Size 399 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021246.2, NP_067069.2
RefSeq Size 402 bp
RefSeq ORF 402 bp
Locus ID 58530
UniProt ID O95868
Cytogenetics 6p21.33
Summary LY6G6D belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIM, Apr 2009]
Write Your Own Review
You're reviewing:LY6G6D (NM_021246) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223536 LY6G6D (Myc-DDK-tagged)-Human lymphocyte antigen 6 complex, locus G6D (LY6G6D) 10 ug
$150.00
RC223536L1 Lenti ORF clone of Human lymphocyte antigen 6 complex, locus G6D (LY6G6D), Myc-DDK-tagged 10 ug
$450.00
RC223536L2 Lenti ORF clone of Human lymphocyte antigen 6 complex, locus G6D (LY6G6D), mGFP tagged 10 ug
$450.00
RC223536L3 Lenti ORF clone of Human lymphocyte antigen 6 complex, locus G6D (LY6G6D), Myc-DDK-tagged 10 ug
$450.00
RC223536L4 Lenti ORF clone of Human lymphocyte antigen 6 complex, locus G6D (LY6G6D), mGFP tagged 10 ug
$450.00
SC304931 LY6G6D (untagged)-Human lymphocyte antigen 6 complex, locus G6D (LY6G6D) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.