Cyclophilin F (PPIF) (NM_005729) Human Tagged ORF Clone

SKU
RG223397
PPIF (tGFP-tagged) - Human peptidylprolyl isomerase F (PPIF), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Cyclophilin F
Synonyms Cyp-D; CyP-M; CYP3; CypD
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG223397 representing NM_005729
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGCGCTGCGCTGCGGCTCCCGCTGGCTCGGCCTGCTCTCCGTCCCGCGCTCCGTGCCGCTGCGCC
TCCCCGCGGCCCGCGCCTGCAGCAAGGGCTCCGGCGACCCGTCCTCTTCCTCCTCCTCCGGGAACCCGCT
CGTGTACCTGGACGTGGACGCCAACGGGAAGCCGCTCGGCCGCGTGGTGCTGGAGCTGAAGGCAGATGTC
GTCCCAAAGACAGCTGAGAACTTCAGAGCCCTGTGCACTGGTGAGAAGGGCTTCGGCTACAAAGGCTCCA
CCTTCCACAGGGTGATCCCTTCCTTCATGTGCCAGGCGGGCGACTTCACCAACCACAATGGCACAGGCGG
GAAGTCCATCTACGGAAGCCGCTTTCCTGACGAGAACTTTACACTGAAGCACGTGGGGCCAGGTGTCCTG
TCCATGGCTAATGCTGGTCCTAACACCAACGGCTCCCAGTTCTTCATCTGCACCATAAAGACAGACTGGT
TGGATGGCAAGCATGTTGTGTTCGGTCACGTCAAAGAGGGCATGGACGTCGTGAAGAAAATAGAATCTTT
CGGCTCTAAGAGTGGGAGGACATCCAAGAAGATTGTCATCACAGACTGTGGCCAGTTGAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG223397 representing NM_005729
Red=Cloning site Green=Tags(s)

MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADV
VPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVL
SMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005729
ORF Size 621 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005729.4
RefSeq Size 2213 bp
RefSeq ORF 624 bp
Locus ID 10105
UniProt ID P30405
Cytogenetics 10q22.3
Domains pro_isomerase
Summary The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is part of the mitochondrial permeability transition pore in the inner mitochondrial membrane. Activation of this pore is thought to be involved in the induction of apoptotic and necrotic cell death. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Cyclophilin F (PPIF) (NM_005729) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC223397 PPIF (Myc-DDK-tagged)-Human peptidylprolyl isomerase F (PPIF), nuclear gene encoding mitochondrial protein 10 ug
$300.00
RC223397L1 Lenti ORF clone of Human peptidylprolyl isomerase F (PPIF), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC223397L2 Lenti ORF clone of Human peptidylprolyl isomerase F (PPIF), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RC223397L3 Lenti ORF clone of Human peptidylprolyl isomerase F (PPIF), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC223397L4 Lenti ORF clone of Human peptidylprolyl isomerase F (PPIF), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
SC116591 PPIF (untagged)-Human peptidylprolyl isomerase F (PPIF), nuclear gene encoding mitochondrial protein 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.