C1orf38 (THEMIS2) (NM_001039477) Human Tagged ORF Clone

SKU
RG222518
THEMIS2 (tGFP-tagged) - Human chromosome 1 open reading frame 38 (C1orf38), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$365.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C1orf38
Synonyms C1orf38; ICB-1; ICB1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG222518 representing NM_001039477
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCGGTGCCGCTGCAGGACTTCGTGCGCGCCTTGGACCCCGCCTCCCTCCCGCGCGTGCTGCGGG
TCTGCTCGGGGGTCTACTTCGAGGGCTCCATCTATGAGATCTCTGGGAATGAGTGCTGCCTCTCCACGGG
GGACCTGATCAAGGTCACCCAGGTCCGCCTCCAGAAGGTGGTCTGTGAGAACCCGAAGACCAGCCAGACC
ATGGAGCTCGCCCCCAACTTCCAGGTCTTCTCAAGTCTTAGGATTGCAGCAACACGCTCGGCTGCCCAAA
CCCAAGGCGAAGACCTTGCCAGAGTTCATCAAGGATGGCTCCAGTACGTACAGCAAGATTCCTGCCCACA
GGAAGGGCCACAGGCCCGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG222518 representing NM_001039477
Red=Cloning site Green=Tags(s)

MEPVPLQDFVRALDPASLPRVLRVCSGVYFEGSIYEISGNECCLSTGDLIKVTQVRLQKVVCENPKTSQT
MELAPNFQVFSSLRIAATRSAAQTQGEDLARVHQGWLQYVQQDSCPQEGPQAR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001039477
ORF Size 369 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001039477.2
RefSeq Size 1236 bp
RefSeq ORF 372 bp
Locus ID 9473
UniProt ID Q5TEJ8
Cytogenetics 1p35.3
Summary May constitute a control point in macrophage inflammatory response, promoting LPS-induced TNF production.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C1orf38 (THEMIS2) (NM_001039477) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222518 THEMIS2 (Myc-DDK-tagged)-Human chromosome 1 open reading frame 38 (C1orf38), transcript variant 2 10 ug
$165.00
RC222518L3 Lenti-ORF clone of THEMIS2 (Myc-DDK-tagged)-Human chromosome 1 open reading frame 38 (C1orf38), transcript variant 2 10 ug
$465.00
RC222518L4 Lenti-ORF clone of THEMIS2 (mGFP-tagged)-Human chromosome 1 open reading frame 38 (C1orf38), transcript variant 2 10 ug
$465.00
SC310873 THEMIS2 (untagged)-Human chromosome 1 open reading frame 38 (C1orf38), transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.