C8 (C8G) (NM_000606) Human Tagged ORF Clone

SKU
RG222236
C8G (tGFP-tagged) - Human complement component 8, gamma polypeptide (C8G)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol C8
Synonyms C8C
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG222236 representing NM_000606
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCCCCCTGGGACTGCGACCCTCTTGACTCTGCTCCTGGCAGCTGGCTCGCTGGGCCAGAAGCCTC
AGAGGCCACGCCGGCCCGCATCCCCCATCAGCACCATCCAGCCCAAGGCCAATTTTGATGCTCAGCAGTT
TGCAGGGACCTGGCTCCTTGTGGCTGTGGGCTCCGCTTGCCGTTTCCTGCAGGAGCAGGGCCACCGGGCC
GAGGCCACCACACTGCATGTGGCTCCCCAGGGCACAGCCATGGCTGTCAGTACCTTCCGAAAGCTGGATG
GGATCTGCTGGCAGGTGCGCCAGCTCTATGGAGACACAGGGGTCCTCGGCCGCTTCCTGCTTCAAGCCCG
AGGCGCCCGAGGGGCTGTGCACGTGGTTGTCGCTGAGACCGACTACCAGAGTTTCGCTGTCCTGTACCTG
GAGCGGGCGGGGCAGCTGTCAGTGAAGCTCTACGCCCGCTCGCTCCCTGTGAGCGACTCGGTCCTGAGTG
GGTTTGAGCAGCGGGTCCAGGAGGCCCACCTGACTGAGGACCAGATCTTCTACTTCCCCAAGTACGGCTT
CTGCGAGGCTGCAGACCAGTTCCACGTCCTGGACGAAGTGAGGAGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG222236 representing NM_000606
Red=Cloning site Green=Tags(s)

MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRA
EATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYL
ERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000606
ORF Size 606 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000606.1, NP_000597.1
RefSeq Size 857 bp
RefSeq ORF 609 bp
Locus ID 733
UniProt ID P07360
Cytogenetics 9q34.3
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Complement and coagulation cascades, Prion diseases, Systemic lupus erythematosus
Summary The protein encoded by this gene belongs to the lipocalin family. It is one of the three subunits that constitutes complement component 8 (C8), which is composed of a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chain. C8 participates in the formation of the membrane attack complex (MAC) on bacterial cell membranes. While subunits alpha and beta play a role in complement-mediated bacterial killing, the gamma subunit is not required for the bactericidal activity. [provided by RefSeq, Jul 2011]
Write Your Own Review
You're reviewing:C8 (C8G) (NM_000606) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC222236 C8G (Myc-DDK-tagged)-Human complement component 8, gamma polypeptide (C8G) 10 ug
$300.00
RC222236L1 Lenti ORF clone of Human complement component 8, gamma polypeptide (C8G), Myc-DDK-tagged 10 ug
$600.00
RC222236L2 Lenti ORF clone of Human complement component 8, gamma polypeptide (C8G), mGFP tagged 10 ug
$600.00
RC222236L3 Lenti ORF clone of Human complement component 8, gamma polypeptide (C8G), Myc-DDK-tagged 10 ug
$600.00
RC222236L4 Lenti ORF clone of Human complement component 8, gamma polypeptide (C8G), mGFP tagged 10 ug
$600.00
SC300107 C8G (untagged)-Human complement component 8, gamma polypeptide (C8G) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.