Snf1lk2 (SIK2) (NM_015191) Human Tagged ORF Clone

CAT#: RG221327

Reviews ()
Write a review
  • TrueORF®

SIK2 (GFP-tagged) - Human salt-inducible kinase 2 (SIK2)



  "NM_015191" in other vectors (7)

Reconstitution Protocol

USD 1,471.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "SIK2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol SIK2
Synonyms LOH11CR1I; QIK; SIK-2; SNF1LK2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG221327 representing NM_015191
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCATGGCGGATGGCCCGAGGCACTTGCAGCGCGGGCCGGTCCGGGTGGGGTTCTACGACATCGAGG
GCACGCTGGGCAAGGGCAACTTCGCTGTGGTGAAGCTGGGGCGGCACCGGATCACCAAGACGGAGGTGGC
AATAAAAATAATCGATAAGTCTCAGCTGGATGCAGTGAACCTTGAGAAAATCTACCGAGAAGTACAAATA
ATGAAAATGTTAGACCACCCTCACATAATCAAACTTTATCAGGTAATGGAGACCAAAAGTATGTTGTACC
TTGTGACAGAATATGCCAAAAATGGAGAAATTTTTGACTATCTTGCTAATCATGGCCGGTTAAATGAGTC
TGAAGCCAGGCGAAAATTCTGGCAAATCCTGTCTGCTGTTGATTATTGTCATGGTCGGAAGATTGTGCAC
CGTGACCTCAAAGCTGAAAATCTCCTGCTGGATAACAACATGAATATCAAAATAGCAGATTTCGGTTTTG
GAAATTTCTTTAAAAGTGGTGAACTGCTGGCAACATGGTGTGGCAGCCCCCCTTATGCAGCCCCAGAAGT
CTTTGAAGGGCAGCAGTATGAAGGACCACAGCTGGACATCTGGAGTATGGGAGTTGTTCTTTATGTCCTT
GTCTGTGGAGCTCTGCCCTTTGATGGACCGACTCTTCCAATTTTGAGGCAGAGGGTTCTGGAAGGAAGAT
TCCGGATTCCGTATTTCATGTCAGAAGATTGCGAGCACCTTATCCGAAGGATGTTGGTCCTAGACCCATC
CAAACGGCTAACCATAGCCCAAATCAAGGAGCATAAATGGATGCTCATAGAAGTTCCTGTCCAGAGACCT
GTTCTCTATCCACAAGAGCAAGAAAATGAGCCATCCATCGGGGAGTTTAATGAGCAGGTTCTGCGACTGA
TGCACAGCCTTGGAATAGATCAGCAGAAAACCATTGAGTCTTTGCAGAACAAGAGCTATAACCACTTTGC
TGCCATTTATTTCTTGTTGGTGGAGCGCCTGAAATCACATCGGAGCAGTTTCCCAGTGGAGCAGAGACTT
GATGGCCGCCAGCGTCGGCCTAGCACCATTGCTGAGCAAACAGTTGCCAAGGCACAGACTGTGGGGCTCC
CAGTGACCATGCATTCACCGAACATGAGGCTGCTGCGATCTGCCCTCCTCCCCCAGGCATCCAACGTGGA
GGCCTTTTCATTTCCAGCATCTGGCTGTCAGGCGGAAGCTGCATTCATGGAAGAAGAGTGTGTGGACACT
CCAAAGGTCAATGGCTGTCTGCTTGACCCTGTGCCTCCTGTCCTGGTGCGGAAGGGATGCCAGTCACTGC
CCAGCAACATGATGGAGACCTCCATTGACGAAGGGCTGGAGACAGAAGGAGAGGCCGAGGAAGACCCCGC
TCATGCCTTTGAGGCATTTCAGTCCACACGCAGCGGGCAGAGACGGCACACTCTGTCAGAAGTGACCAAT
CAACTGGTCGTGATGCCTGGGGCAGGGAAAATTTTCTCCATGAATGACAGCCCCTCCCTTGACAGTGTGG
ACTCTGAGTATGATATGGGGTCTGTTCAGAGGGACCTGAACTTTCTGGAAGACAACCCTTCCCTTAAGGA
CATCATGTTAGCCAATCAGCCTTCACCCCGCATGACATCTCCCTTCATAAGCCTGAGACCTACCAACCCA
GCCATGCAGGCTCTGAGCTCCCAGAAACGAGAGGTCCACAACAGGTCTCCAGTGAGCTTCAGAGAGGGCC
GCAGAGCATCAGATACCTCCCTCACCCAGGGAATTGTAGCATTTAGACAACATCTTCAGAATCTGGCTAG
AACCAAAGGAATTCTAGAGTTGAACAAAGTGCAGTTGTTGTATGAACAAATAGGACCGGAGGCAGACCCT
AACCTGGCGCCGGCGGCTCCTCAGCTCCAGGACCTTGCTAGCAGCTGCCCTCAGGAAGAAGTTTCTCAGC
AGCAGGAAAGCGTCTCCACTCTCCCTGCCAGCGTGCATCCCCAGCTGTCCCCACGGCAGAGCCTGGAGAC
CCAGTACCTGCAGCACAGACTCCAGAAGCCCAGCCTTCTGTCAAAGGCCCAGAACACCTGTCAGCTTTAT
TGCAAAGAACCACCGCGGAGCCTTGAGCAGCAGCTGCAGGAACATAGGCTCCAGCAGAAGCGACTCTTTC
TTCAGAAGCAGTCTCAACTGCAGGCCTATTTTAATCAGATGCAGATAGCAGAGAGCTCCTACCCACAGCC
AAGTCAGCAGCTGCCCCTTCCCCGCCAGGAGACTCCACCGCCTTCTCAGCAGGCCCCACCGTTCAGCCTG
ACCCAGCCCCTGAGCCCCGTCCTGGAGCCTTCCTCCGAGCAGATGCAATACAGCCCTTTCCTCAGCCAGT
ACCAAGAGATGCAGCTTCAGCCCCTGCCCTCCACTTCCGGTCCCCGGGCTGCTCCTCCTCTGCCCACGCA
GCTACAGCAGCAGCAGCCGCCACCGCCACCACCCCCTCCACCACCACGACAGCCAGGAGCTGCCCCAGCC
CCCTTACAGTTCTCCTATCAGACTTGTGAGCTGCCAAGCGCTGCTTCCCCTGCGCCAGACTATCCCACTC
CCTGTCAGTATCCTGTGGATGGAGCCCAGCAGAGCGACCTAACGGGGCCAGACTGTCCCAGAAGCCCAGG
ACTGCAAGAGGCCCCCTCCAGCTACGACCCACTAGCCCTCTCTGAGCTACCTGGACTCTTTGATTGTGAA
ATGCTAGACGCTGTGGATCCACAACACAACGGGTATGTCCTGGTGAAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG221327 representing NM_015191
Red=Cloning site Green=Tags(s)

MVMADGPRHLQRGPVRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVNLEKIYREVQI
MKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEARRKFWQILSAVDYCHGRKIVH
RDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSPPYAAPEVFEGQQYEGPQLDIWSMGVVLYVL
VCGALPFDGPTLPILRQRVLEGRFRIPYFMSEDCEHLIRRMLVLDPSKRLTIAQIKEHKWMLIEVPVQRP
VLYPQEQENEPSIGEFNEQVLRLMHSLGIDQQKTIESLQNKSYNHFAAIYFLLVERLKSHRSSFPVEQRL
DGRQRRPSTIAEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFSFPASGCQAEAAFMEEECVDT
PKVNGCLLDPVPPVLVRKGCQSLPSNMMETSIDEGLETEGEAEEDPAHAFEAFQSTRSGQRRHTLSEVTN
QLVVMPGAGKIFSMNDSPSLDSVDSEYDMGSVQRDLNFLEDNPSLKDIMLANQPSPRMTSPFISLRPTNP
AMQALSSQKREVHNRSPVSFREGRRASDTSLTQGIVAFRQHLQNLARTKGILELNKVQLLYEQIGPEADP
NLAPAAPQLQDLASSCPQEEVSQQQESVSTLPASVHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLY
CKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQIAESSYPQPSQQLPLPRQETPPPSQQAPPFSL
TQPLSPVLEPSSEQMQYSPFLSQYQEMQLQPLPSTSGPRAAPPLPTQLQQQQPPPPPPPPPPRQPGAAPA
PLQFSYQTCELPSAASPAPDYPTPCQYPVDGAQQSDLTGPDCPRSPGLQEAPSSYDPLALSELPGLFDCE
MLDAVDPQHNGYVLVN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_015191
ORF Size 2778 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_015191.3
RefSeq Size 5694 bp
RefSeq ORF 2781 bp
Locus ID 23235
UniProt ID Q9H0K1
Cytogenetics 11q23.1
Protein Families Druggable Genome, Protein Kinase
Gene Summary Phosphorylates 'Ser-794' of IRS1 in insulin-stimulated adipocytes, potentially modulating the efficiency of insulin signal transduction. Inhibits CREB activity by phosphorylating and repressing TORCs, the CREB-specific coactivators.[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.