PACAP (ADCYAP1) (NM_001099733) Human Tagged ORF Clone

SKU
RG221298
ADCYAP1 (tGFP-tagged) - Human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PACAP
Synonyms PACAP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG221298 representing NM_001099733
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCATGTGTAGCGGAGCGAGGCTGGCCCTGCTGGTCTATGGGATAATCATGCACAGCAGCGTCTACA
GCTCACCTGCCGCCGCCGGACTCCGGTTCCCCGGGATCAGGCCAGAGGAAGAGGCGTACGGCGAGGACGG
AAACCCGCTGCCAGACTTCGATGGCTCGGAGCCGCCGGGCGCAGGGAGCCCCGCCTCCGCGCCGCGCGCC
GCCGCCGCCTGGTACCGCCCGGCCGGGAGAAGAGATGTCGCCCACGGGATCCTTAACGAGGCCTACCGCA
AAGTGCTGGACCAGCTGTCCGCCGGGAAGCACCTGCAGTCGCTCGTGGCCCGGGGCGTGGGTGGGAGCCT
CGGCGGCGGCGCGGGGGACGACGCGGAGCCGCTCTCCAAGCGCCACTCGGACGGGATCTTCACGGACAGC
TACAGCCGCTACCGGAAACAAATGGCTGTCAAGAAATACTTGGCGGCCGTCCTAGGGAAGAGGTATAAAC
AAAGGGTTAAAAACAAAGGACGCCGAATAGCTTATTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG221298 representing NM_001099733
Red=Cloning site Green=Tags(s)

MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA
AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS
YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001099733
ORF Size 528 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001099733.2
RefSeq Size 3187 bp
RefSeq ORF 531 bp
Locus ID 116
UniProt ID P18509
Cytogenetics 18p11.32
Protein Families Secreted Protein
Summary This gene encodes a secreted proprotein that is further processed into multiple mature peptides. These peptides stimulate adenylate cyclase and increase cyclic adenosine monophosphate (cAMP) levels, resulting in the transcriptional activation of target genes. The products of this gene are key mediators of neuroendocrine stress responses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2013]
Write Your Own Review
You're reviewing:PACAP (ADCYAP1) (NM_001099733) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC221298 ADCYAP1 (Myc-DDK-tagged)-Human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 10 ug
$300.00
RC221298L1 Lenti ORF clone of Human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC221298L2 Lenti ORF clone of Human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC221298L3 Lenti ORF clone of Human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC221298L4 Lenti ORF clone of Human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1, mGFP tagged 10 ug
$600.00
SC316669 ADCYAP1 (untagged)-Human adenylate cyclase activating polypeptide 1 (pituitary) (ADCYAP1), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.