Relaxin 2 (RLN2) (NM_134441) Human Tagged ORF Clone

SKU
RG220665
RLN2 (tGFP-tagged) - Human relaxin 2 (RLN2), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Relaxin 2
Synonyms bA12D24.1.1; bA12D24.1.2; H2; H2-RLX; RLXH2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG220665 representing NM_134441
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCGCCTGTTTTTTTTCCACCTGCTAGGAGTCTGTTTACTACTGAACCAATTTTCCAGAGCAGTCG
CGGACTCATGGATGGAGGAAGTTATTAAATTATGCGGCCGCGAATTAGTTCGCGCGCAGATTGCCATTTG
CGGCATGAGCACCTGGAGCAAAAGGTCTCTGAGCCAGGAAGATGCTCCTCAGACACCTAGACCAGTGGCA
GAAATTGTGCCATCCTTCATCAACAAAGATACAGAAACCATAAATATGATGTCAGAATTTGTTGCTAATT
TGCCACAGGAGCTGAAGTTAACCCTGTCTGAGATGCAGCCAGCATTACCACAGCTACAACAACATGTACC
TGTATTAAAAGATTCCAGTCTTCTCTTTGAAGAATTTAAGAAACTTATTCGCAATAGACAAAGTGAAGCC
GCAGACAGCAGTCCTTCAGAATTAAAATACTTAGGCTTGGATACTCATTCTCGAAAAAAGAGACAACTCT
ACAGTGCATTGGCTAATAAATGTTGCCATGTTGGTTGTACCAAAAGATCTCTTGCTAGATTTTGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG220665 representing NM_134441
Red=Cloning site Green=Tags(s)

MPRLFFFHLLGVCLLLNQFSRAVADSWMEEVIKLCGRELVRAQIAICGMSTWSKRSLSQEDAPQTPRPVA
EIVPSFINKDTETINMMSEFVANLPQELKLTLSEMQPALPQLQQHVPVLKDSSLLFEEFKKLIRNRQSEA
ADSSPSELKYLGLDTHSRKKRQLYSALANKCCHVGCTKRSLARFC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_134441
ORF Size 555 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_134441.3
RefSeq Size 788 bp
RefSeq ORF 558 bp
Locus ID 6019
UniProt ID P04090
Cytogenetics 9p24.1
Protein Families Secreted Protein
Summary This gene encodes a member of the relaxin subfamily and insulin superfamily of peptide hormones. In humans there are three non-allelic relaxin genes. This gene encodes multiple protein isoforms, at least one of which undergoes proteolytic processing. This processing generates relaxin A and B chains that are linked by disulfide bonds to form the mature peptide hormone. This hormone plays a role in the male and female reproductive systems and was initially noted for its role in pregnancy. This protein also plays broader roles in the cardiovascular system, including in the regulation of blood pressure and control of heart rate, and data from animal models shows that this protein may have anti-fibrotic and cardioprotective effects. [provided by RefSeq, Jul 2016]
Write Your Own Review
You're reviewing:Relaxin 2 (RLN2) (NM_134441) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220665 RLN2 (Myc-DDK-tagged)-Human relaxin 2 (RLN2), transcript variant 1 10 ug
$289.00 MSRP $300.00 MSRP $300.00
RC220665L3 Lenti ORF clone of Human relaxin 2 (RLN2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC220665L4 Lenti ORF clone of Human relaxin 2 (RLN2), transcript variant 1, mGFP tagged 10 ug
$600.00
SC309115 RLN2 (untagged)-Human relaxin 2 (RLN2), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.