RNASE4 (NM_002937) Human Tagged ORF Clone

SKU
RG220443
RNASE4 (tGFP-tagged) - Human ribonuclease, RNase A family, 4 (RNASE4), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RNASE4
Synonyms RAB1; RNS4
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG220443 representing NM_002937
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCTGCAGAGGACCCATTCATTGCTTCTGCTTTTGCTGCTGACCCTGCTGGGGCTGGGGCTGGTCC
AGCCCTCCTATGGCCAGGATGGCATGTACCAGCGATTCCTGCGGCAACACGTGCACCCTGAGGAGACAGG
TGGCAGTGATCGCTACTGCAACTTGATGATGCAAAGACGGAAGATGACTTTGTATCACTGCAAGCGCTTC
AACACCTTCATCCATGAAGATATCTGGAACATTCGTAGTATCTGCAGCACCACCAATATCCAATGCAAGA
ACGGCAAGATGAACTGCCATGAGGGTGTAGTGAAGGTCACAGATTGCAGGGACACAGGAAGTTCCAGGGC
ACCCAACTGCAGATATCGGGCCATAGCGAGCACTAGACGTGTTGTCATTGCCTGTGAGGGTAACCCACAG
GTGCCTGTGCACTTTGACGGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG220443 representing NM_002937
Red=Cloning site Green=Tags(s)

MALQRTHSLLLLLLLTLLGLGLVQPSYGQDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRF
NTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQ
VPVHFDG

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002937
ORF Size 441 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002937.5
RefSeq Size 1805 bp
RefSeq ORF 444 bp
Locus ID 6038
UniProt ID P34096
Cytogenetics 14q11.2
Domains RNAse_Pc
Protein Families Secreted Protein, Transmembrane
Summary The protein encoded by this gene belongs to the pancreatic ribonuclease family. It plays an important role in mRNA cleavage and has marked specificity towards the 3' side of uridine nucleotides. Alternative splicing results in four transcript variants encoding the same protein. This gene and the gene that encodes angiogenin share promoters and 5' exons. Each gene splices to a unique downstream exon that contains its complete coding region. [provided by RefSeq, Aug 2013]
Write Your Own Review
You're reviewing:RNASE4 (NM_002937) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220443 RNASE4 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 4 (RNASE4), transcript variant 2 10 ug
$150.00
RC220443L1 Lenti ORF clone of Human ribonuclease, RNase A family, 4 (RNASE4), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC220443L2 Lenti ORF clone of Human ribonuclease, RNase A family, 4 (RNASE4), transcript variant 2, mGFP tagged 10 ug
$450.00
RC220443L3 Lenti ORF clone of Human ribonuclease, RNase A family, 4 (RNASE4), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC220443L4 Lenti ORF clone of Human ribonuclease, RNase A family, 4 (RNASE4), transcript variant 2, mGFP tagged 10 ug
$450.00
SC118284 RNASE4 (untagged)-Human ribonuclease, RNase A family, 4 (RNASE4), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.