MRPL30 (NM_145213) Human Tagged ORF Clone

SKU
RG220428
MRPL30 (tGFP-tagged) - Human mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MRPL30
Synonyms FLJ44438; MGC3314; MGC24095; mitochondrial ribosomal protein L30; MRP-L28; MRPL28; OTTHUMP00000161222; RPML28
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG220428 representing NM_145213
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGGGATTTTGCGCTTAGTAGTTCAATGGCCCCCAGGCAGACTACAGACCGTGACAAAAGGTGTGG
AGTCTCTTATTTGTACAGATTGGATTCGTCACAAATTCACCAGATCAAGAATTCCAGAAAAAGTGTTTCA
GGCCTCACCTGAAGATCATGAAAAATACGGTGGGGATCCACAGAACCCTCATAAACTGCATATTGTTACC
AGAATAAAAAGTACAAGAAGACGTCCATATTGGGAAAAAGATATAATAAAGATGCTTGGATTAGAAAAAG
CACATACCCCTCAAGTTCACAAGAATATCCCTTCAGTGAATGCAAAATTGAAAGTAGTTAAGCATTTGAT
AAGAATCAAGCCCTTGAAGTTGCCACAAGGACTTCCAGCAGAGGAGAACATGTCTAACACGTGCCTCAAA
AGCACTGGGGAGTTAGTAGTGCAGTGGCATCTGAAACCTGTGGAGCAGAAAGCACATGAGTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG220428 representing NM_145213
Red=Cloning site Green=Tags(s)

MAGILRLVVQWPPGRLQTVTKGVESLICTDWIRHKFTRSRIPEKVFQASPEDHEKYGGDPQNPHKLHIVT
RIKSTRRRPYWEKDIIKMLGLEKAHTPQVHKNIPSVNAKLKVVKHLIRIKPLKLPQGLPAEENMSNTCLK
STGELVVQWHLKPVEQKAHES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145213
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145213.1, NP_660214.1
RefSeq Size 1010 bp
RefSeq ORF 485 bp
Locus ID 51263
Cytogenetics 2q11.2
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Alternative splicing results in multiple transcript variants. Pseudogenes corresponding to this gene are found on chromosomes 6p and 12p. Read-through transcription also exists between this gene and the neighboring upstream lipoyltransferase 1 (LIPT1) gene. [provided by RefSeq, Mar 2011]
Write Your Own Review
You're reviewing:MRPL30 (NM_145213) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220428 MRPL30 (Myc-DDK-tagged)-Human mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 3 10 ug
$150.00
RC220428L3 Lenti ORF clone of Human mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 3, Myc-DDK-tagged 10 ug
$450.00
RC220428L4 Lenti ORF clone of Human mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 3, mGFP tagged 10 ug
$450.00
SC124300 MRPL30 (untagged)-Human mitochondrial ribosomal protein L30 (MRPL30), nuclear gene encoding mitochondrial protein, transcript variant 3 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.