PF4V1 (NM_002620) Human Tagged ORF Clone

SKU
RG220116
PF4V1 (tGFP-tagged) - Human platelet factor 4 variant 1 (PF4V1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PF4V1
Synonyms CXCL4L1; CXCL4V1; PF4-ALT; PF4A; SCYB4V1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG220116 representing NM_002620
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTCCGCAGCCAGGTCCCGCCTCACCCGCGCCACCCGCCAGGAGATGCTGTTCTTGGCGTTGCTGC
TCCTGCCAGTTGTGGTCGCCTTCGCCAGAGCTGAAGCTGAAGAAGATGGGGACCTGCAGTGCCTGTGTGT
GAAGACCACCTCCCAGGTCCGTCCCAGGCACATCACCAGCCTGGAGGTGATCAAGGCCGGACCCCACTGC
CCCACTGCCCAACTCATAGCCACGCTGAAGAATGGGAGGAAAATTTGCTTGGATCTGCAAGCCCTGCTGT
ACAAGAAAATCATTAAGGAACATTTGGAGAGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG220116 representing NM_002620
Red=Cloning site Green=Tags(s)

MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHC
PTAQLIATLKNGRKICLDLQALLYKKIIKEHLES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002620
ORF Size 312 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002620.4
RefSeq Size 755 bp
RefSeq ORF 315 bp
Locus ID 5197
UniProt ID P10720
Cytogenetics 4q13.3
Protein Families Secreted Protein
Protein Pathways Chemokine signaling pathway, Cytokine-cytokine receptor interaction
Summary The protein encoded by this gene is a chemokine that is highly similar to platelet factor 4. The encoded protein displays a strong antiangiogenic function and is regulated by chemokine (C-X-C motif) receptor 3. This protein also impairs tumor growth and can protect against blood-retinal barrier breakdown in diabetes patients. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:PF4V1 (NM_002620) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220116 PF4V1 (Myc-DDK-tagged)-Human platelet factor 4 variant 1 (PF4V1) 10 ug
$150.00
RC220116L3 Lenti ORF clone of Human platelet factor 4 variant 1 (PF4V1), Myc-DDK-tagged 10 ug
$450.00
RC220116L4 Lenti ORF clone of Human platelet factor 4 variant 1 (PF4V1), mGFP tagged 10 ug
$450.00
SC303229 PF4V1 (untagged)-Human platelet factor 4 variant 1 (PF4V1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.