CAMK2N1 (NM_018584) Human Tagged ORF Clone

SKU
RG220095
CAMK2N1 (tGFP-tagged) - Human calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CAMK2N1
Synonyms PRO1489
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG220095 representing NM_018584
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGAGGTGCTGCCCTACGGCGACGAGAAGCTGAGCCCCTACGGCGACGGCGGCGACGTGGGCCAGA
TCTTCTCCTGCCGCCTGCAGGACACCAACAACTTCTTCGGCGCCGGGCAGAACAAGCGGCCGCCCAAGCT
GGGCCAGATCGGCCGGAGCAAGCGGGTTGTTATTGAAGATGATAGGATTGATGACGTGCTGAAAAATATG
ACCGACAAGGCACCTCCTGGTGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG220095 representing NM_018584
Red=Cloning site Green=Tags(s)

MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNM
TDKAPPGV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_018584
ORF Size 234 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018584.6
RefSeq Size 860 bp
RefSeq ORF 237 bp
Locus ID 55450
UniProt ID Q7Z7J9
Cytogenetics 1p36.12
Protein Families Druggable Genome
Summary Potent and specific inhibitor of CaM-kinase II (CAMK2).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CAMK2N1 (NM_018584) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC220095 CAMK2N1 (Myc-DDK-tagged)-Human calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1) 10 ug
$150.00
RC220095L1 Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1), Myc-DDK-tagged 10 ug
$450.00
RC220095L2 Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1), mGFP tagged 10 ug
$450.00
RC220095L3 Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1), Myc-DDK-tagged 10 ug
$450.00
RC220095L4 Lenti ORF clone of Human calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1), mGFP tagged 10 ug
$450.00
SC113435 CAMK2N1 (untagged)-Human calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.