Galectin 10 (CLC) (NM_001828) Human Tagged ORF Clone

SKU
RG219689
CLC (tGFP-tagged) - Human Charcot-Leyden crystal protein (CLC)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Galectin 10
Synonyms Gal-10; GAL10; LGALS10; LGALS10A; LPPL_HUMAN
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG219689 representing NM_001828
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCTGCTACCCGTGCCATACACAGAGGCTGCCTCTTTGTCTACTGGTTCTACTGTGACAATCAAAG
GGCGACCACTTGTCTGTTTCTTGAATGAACCATATCTGCAGGTGGATTTCCACACTGAGATGAAGGAGGA
ATCAGACATTGTCTTCCATTTCCAAGTGTGCTTTGGTCGTCGTGTGGTCATGAACAGCCGTGAGTATGGG
GCCTGGAAGCAGCAGGTGGAATCCAAGAACATGCCCTTTCAGGATGGCCAAGAATTTGAACTGAGCATCT
CAGTGCTGCCAGATAAGTACCAGGTAATGGTCAATGGCCAATCCTCTTACACCTTTGACCATAGAATCAA
GCCTGAGGCTGTGAAGATGGTGCAAGTGTGGAGAGATATCTCCCTGACCAAATTTAATGTCAGCTATTTA
AAGAGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG219689 representing NM_001828
Red=Cloning site Green=Tags(s)

MSLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYG
AWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYL
KR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001828
ORF Size 426 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001828.3
RefSeq Size 641 bp
RefSeq ORF 429 bp
Locus ID 1178
UniProt ID Q05315
Cytogenetics 19q13.2
Domains Gal-bind_lectin
Protein Families Secreted Protein
Summary Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Galectin 10 (CLC) (NM_001828) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219689 CLC (Myc-DDK-tagged)-Human Charcot-Leyden crystal protein (CLC) 10 ug
$150.00
RC219689L3 Lenti ORF clone of Human Charcot-Leyden crystal protein (CLC), Myc-DDK-tagged 10 ug
$450.00
RC219689L4 Lenti ORF clone of Human Charcot-Leyden crystal protein (CLC), mGFP tagged 10 ug
$450.00
SC118974 CLC (untagged)-Human Charcot-Leyden crystal protein (CLC) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.