SAP155 (SF3B1) (NM_001005526) Human Tagged ORF Clone

SKU
RG219649
SF3B1 (tGFP-tagged) - Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SAP155
Synonyms Hsh155; MDS; PRP10; PRPF10; SAP155; SF3b155
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG219649 representing NM_001005526
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAAGATCGCCAAGACTCACGAAGATATTGAAGCACAGATTCGAGAAATTCAAGGCAAGAAGGCAG
CTCTTGATGAAGCTCAAGGAGTGGGCCTCGATTCTACAGGTTATTATGACCAGGAAATTTATGGTGGAAG
TGACAGCAGATTTGCTGGATACGTGACATCAATTGCTGCAACTGAACTTGAAGATGATGACGATGACTAT
TCATCATCTACGAGTTTGCTTGGTCAGAAGAAGCCAGGATATCATGCCCCTGTGGCATTGCTTAATGATA
TACCACAGTCAACAGAACAGTATGATCCATTTGCTGAGCACAGACCTCCAAAGATTGCAGACCGGGAAGA
TGAATACAAAAAGCATAGGCGGACCATGATAATTTCCCCAGAGCGTCTTGATCCTTTTGCAGATGGCTTC
TATTCTGCTGCT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG219649 representing NM_001005526
Red=Cloning site Green=Tags(s)

MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSRFAGYVTSIAATELEDDDDDY
SSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADGF
YSAA

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001005526
ORF Size 432 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001005526.2, NP_001005526.1
RefSeq Size 647 bp
RefSeq ORF 435 bp
Locus ID 23451
Cytogenetics 2q33.1
Protein Pathways Spliceosome
Summary This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:SAP155 (SF3B1) (NM_001005526) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219649 SF3B1 (Myc-DDK-tagged)-Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2 10 ug
$225.00
RC219649L1 Lenti ORF clone of Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2, Myc-DDK-tagged 10 ug
$525.00
RC219649L2 Lenti ORF clone of Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2, mGFP tagged 10 ug
$525.00
RC219649L3 Lenti ORF clone of Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2, Myc-DDK-tagged 10 ug
$525.00
RC219649L4 Lenti ORF clone of Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2, mGFP tagged 10 ug
$525.00
SC300999 SF3B1 (untagged)-Human splicing factor 3b, subunit 1, 155kDa (SF3B1), transcript variant 2 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.