IL29 (IFNL1) (NM_172140) Human Tagged ORF Clone

SKU
RG219027
IFNL1 (tGFP-tagged) - Human interleukin 29 (interferon, lambda 1) (IL29)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IL29
Synonyms IL-29; IL29
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG219027 representing NM_172140
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCAGCTTGGACCGTGGTGCTGGTGACTTTGGTGCTAGGCTTGGCCGTGGCAGGCCCTGTCCCCA
CTTCCAAGCCCACCACAACTGGGAAGGGCTGCCACATTGGCAGGTTCAAATCTCTGTCACCACAGGAGCT
AGCGAGCTTCAAGAAGGCCAGGGACGCCTTGGAAGAGTCACTCAAGCTGAAAAACTGGAGTTGCAGCTCT
CCTGTCTTCCCCGGGAATTGGGACCTGAGGCTTCTCCAGGTGAGGGAGCGCCCTGTGGCCTTGGAGGCTG
AGCTGGCCCTGACGCTGAAGGTCCTGGAGGCCGCTGCTGGCCCAGCCCTGGAGGACGTCCTAGACCAGCC
CCTTCACACCCTGCACCACATCCTCTCCCAGCTCCAGGCCTGTATCCAGCCTCAGCCCACAGCAGGGCCC
AGGCCCCGGGGCCGCCTCCACCACTGGCTGCACCGGCTCCAGGAGGCCCCCAAAAAGGAGTCCGCTGGCT
GCCTGGAGGCATCTGTCACCTTCAACCTCTTCCGCCTCCTCACGCGAGACCTCAAATATGTGGCCGATGG
GAACCTGTGTCTGAGAACGTCAACCCACCCTGAGTCCACC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG219027 representing NM_172140
Red=Cloning site Green=Tags(s)

MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSS
PVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGP
RPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_172140
ORF Size 600 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_172140.2
RefSeq Size 856 bp
RefSeq ORF 603 bp
Locus ID 282618
UniProt ID Q8IU54
Cytogenetics 19q13.2
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway
Summary This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:IL29 (IFNL1) (NM_172140) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC219027 IFNL1 (Myc-DDK-tagged)-Human interleukin 29 (interferon, lambda 1) (IL29) 10 ug
$300.00
RC219027L1 Lenti ORF clone of Human interleukin 29 (interferon, lambda 1) (IL29), Myc-DDK-tagged 10 ug
$600.00
RC219027L2 Lenti ORF clone of Human interleukin 29 (interferon, lambda 1) (IL29), mGFP tagged 10 ug
$600.00
RC219027L3 Lenti ORF clone of Human interleukin 29 (interferon, lambda 1) (IL29), Myc-DDK-tagged 10 ug
$600.00
RC219027L4 Lenti ORF clone of Human interleukin 29 (interferon, lambda 1) (IL29), mGFP tagged 10 ug
$600.00
SC306727 IFNL1 (untagged)-Human interleukin 29 (interferon, lambda 1) (IL29) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.