Interferon beta (IFNB1) (NM_002176) Human Tagged ORF Clone

SKU
RG218565
IFNB1 (tGFP-tagged) - Human interferon, beta 1, fibroblast (IFNB1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Interferon beta
Synonyms IFB; IFF; IFN-beta; IFNB
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
Protein Sequence
>RG218565 representing NM_002176
Red=Cloning site Green=Tags(s)

MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQ
FQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSS
LHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_002176
ORF Size 561 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_002176.4
RefSeq Size 840 bp
RefSeq ORF 564 bp
Locus ID 3456
UniProt ID P01574
Cytogenetics 9p21.3
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, RIG-I-like receptor signaling pathway, Toll-like receptor signaling pathway
Summary This gene encodes a cytokine that belongs to the interferon family of signaling proteins, which are released as part of the innate immune response to pathogens. The protein encoded by this gene belongs to the type I class of interferons, which are important for defense against viral infections. In addition, type I interferons are involved in cell differentiation and anti-tumor defenses. Following secretion in response to a pathogen, type I interferons bind a homologous receptor complex and induce transcription of genes such as those encoding inflammatory cytokines and chemokines. Overactivation of type I interferon secretion is linked to autoimmune diseases. Mice deficient for this gene display several phenotypes including defects in B cell maturation and increased susceptibility to viral infection. [provided by RefSeq, Sep 2015]
Write Your Own Review
You're reviewing:Interferon beta (IFNB1) (NM_002176) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218565 IFNB1 (Myc-DDK-tagged)-Human interferon, beta 1, fibroblast (IFNB1) 10 ug
$450.00
RC218565L1 Lenti ORF clone of Human interferon, beta 1, fibroblast (IFNB1), Myc-DDK-tagged 10 ug
$750.00
RC218565L2 Lenti ORF clone of Human interferon, beta 1, fibroblast (IFNB1), mGFP tagged 10 ug
$750.00
RC218565L3 Lenti ORF clone of Human interferon, beta 1, fibroblast (IFNB1), Myc-DDK-tagged 10 ug
$750.00
RC218565L4 Lenti ORF clone of Human interferon, beta 1, fibroblast (IFNB1), mGFP tagged 10 ug
$750.00
SC127861 IFNB1 (untagged)-Human interferon, beta 1, fibroblast (IFNB1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.