CMTM7 (NM_181472) Human Tagged ORF Clone

SKU
RG218395
CMTM7 (tGFP-tagged) - Human CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CMTM7
Synonyms CKLFSF7
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG218395 representing NM_181472
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCACGGAGCCGGGCTCGTCCGCACCACGTGCAGCAGCGGCAGCGCGCTCGGACCCGGGGCCGGCG
CGGCCCAGCCCAGCGCGAGCCCCTTGGAGGGGCTGCTGGACCTCAGCTACCCCCGCACCCACGCGGCCCT
GCTGAAAGTGGCGCAAATGGTCACCCTGCTGATTGCCTTCATCTGTGTGCGGAGCTCCCTGTGGACCAAC
TACAGCGCCTACAGCTACTTTGAAGTGGTCACCATTTGCGACTTGATAATGATCCTCGCCTTTTACCTGG
TCCACCTCTTCCGCTTCTACCGCGTGCTCACCTGTATCAGCTGGCCCCTGTCGATCTTTGGTTTCATGGC
CACCTTCCTCTGCATGGCAAGCATATGGCTGTCCTATAAGATCTCGTGTGTAACCCAGTCCACAGATGCA
GCCGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG218395 representing NM_181472
Red=Cloning site Green=Tags(s)

MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTN
YSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSIFGFMATFLCMASIWLSYKISCVTQSTDA
AV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181472
ORF Size 426 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181472.3
RefSeq Size 1270 bp
RefSeq ORF 429 bp
Locus ID 112616
UniProt ID Q96FZ5
Cytogenetics 3p22.3
Protein Families Transmembrane
Summary This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016]
Write Your Own Review
You're reviewing:CMTM7 (NM_181472) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218395 CMTM7 (Myc-DDK-tagged)-Human CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 2 10 ug
$289.00
RC218395L3 Lenti ORF clone of Human CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC218395L4 Lenti ORF clone of Human CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 2, mGFP tagged 10 ug
$450.00
SC309697 CMTM7 (untagged)-Human CKLF-like MARVEL transmembrane domain containing 7 (CMTM7), transcript variant 2 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.