MMP28 (NM_001032278) Human Tagged ORF Clone

SKU
RG218383
MMP28 (tGFP-tagged) - Human matrix metallopeptidase 28 (MMP28), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MMP28
Synonyms EPILYSIN; MM28; MMP-25; MMP-28; MMP25
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG218383 representing NM_001032278
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCGCGCGCGTCGGCCTCCTGCTGCGCGCCCTGCAGCTGCTACTGTGGGGCCACCTGGACGCCCAGC
CCGCGGAGCGCGGAGGCCAGGAGCTGCGCAAGGAGGCGGAGGCATTCCTAGAGAAGTACGGATACCTCAA
TGAACAGGTCCCCAAAGCTCCCACCTCCACTCGATTCAGCGATGCCATCAGAGCGTTTCAGTGGGTGTCC
CAGCTACCTGTCAGCGGCGTGTTGGACCGCGCCACCCTGCGCCAGATGACTCGTCCCCGCTGCGGGGTTA
CAGATACCAACAGTTATGCGGCCTGGGCTGAGAGGATCAGTGACTTGTTTGCTAGACACCGGACCAAAAT
GAGGCGTAAGAAACGCTTTGCAAAGCAAGGTGAGCACTGT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG218383 representing NM_001032278
Red=Cloning site Green=Tags(s)

MVARVGLLLRALQLLLWGHLDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWVS
QLPVSGVLDRATLRQMTRPRCGVTDTNSYAAWAERISDLFARHRTKMRRKKRFAKQGEHC

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001032278
ORF Size 390 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001032278.3
RefSeq Size 1042 bp
RefSeq ORF 393 bp
Locus ID 79148
UniProt ID Q9H239
Cytogenetics 17q12
Protein Families Druggable Genome, Protease, Secreted Protein
Summary Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix for both normal physiological processes, such as embryonic development, reproduction and tissue remodeling, and disease processes, such as asthma and metastasis. This gene encodes a secreted enzyme that degrades casein. Its expression pattern suggests that it plays a role in tissue homeostasis and in wound repair. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2014]
Write Your Own Review
You're reviewing:MMP28 (NM_001032278) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218383 MMP28 (Myc-DDK-tagged)-Human matrix metallopeptidase 28 (MMP28), transcript variant 3 10 ug
$289.00
RC218383L3 Lenti ORF clone of Human matrix metallopeptidase 28 (MMP28), transcript variant 3, Myc-DDK-tagged 10 ug
$450.00
RC218383L4 Lenti ORF clone of Human matrix metallopeptidase 28 (MMP28), transcript variant 3, mGFP tagged 10 ug
$450.00
SC302618 MMP28 (untagged)-Human matrix metallopeptidase 28 (MMP28), transcript variant 3 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.