Secretin (SCT) (NM_021920) Human Tagged ORF Clone

SKU
RG218129
SCT (tGFP-tagged) - Human secretin (SCT)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Secretin
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG218129 representing NM_021920
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCCCCGGCCCCTCCTGCTGCTGCTGCTGCTCCTCGGGGGCTCCGCCGCGCGCCCCGCGCCCCCCA
GGGCCCGGCGACACTCAGACGGGACGTTCACCAGCGAGCTCAGCCGCCTGCGGGAGGGCGCGCGGCTCCA
GCGGCTGCTACAGGGCCTGGTGGGGAAGCGCAGCGAGCAGGACGCAGAGAACAGCATGGCCTGGACCAGG
CTCAGCGCGGGTCTGCTCTGCCCGTCAGGGTCCAACATGCCCATCCTGCAGGCCTGGATGCCCCTGGACG
GGACCTGGTCTCCCTGGCTGCCCCCTGGGCCTATGGTTTCAGAACCAGCTGGCGCTGCTGCAGAAGGAAC
CTTGCGGCCCAGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG218129 representing NM_021920
Red=Cloning site Green=Tags(s)

MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTR
LSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021920
ORF Size 363 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021920.4
RefSeq Size 514 bp
RefSeq ORF 366 bp
Locus ID 6343
UniProt ID P09683
Cytogenetics 11p15.5
Protein Families Druggable Genome, Secreted Protein
Summary This gene encodes a member of the glucagon family of peptides. The encoded preproprotein is secreted by endocrine S cells in the proximal small intestinal mucosa as a prohormone, then proteolytically processed to generate the mature peptide hormone. The release of this active peptide hormone is stimulated by either fatty acids or acidic pH in the duodenum. This hormone stimulates the secretion of bile and bicarbonate in the duodenum, pancreatic and biliary ducts. [provided by RefSeq, Feb 2016]
Write Your Own Review
You're reviewing:Secretin (SCT) (NM_021920) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC218129 SCT (Myc-DDK-tagged)-Human secretin (SCT) 10 ug
$150.00
RC218129L1 Lenti ORF clone of Human secretin (SCT), Myc-DDK-tagged 10 ug
$450.00
RC218129L2 Lenti ORF clone of Human secretin (SCT), mGFP tagged 10 ug
$450.00
RC218129L3 Lenti ORF clone of Human secretin (SCT), Myc-DDK-tagged 10 ug
$450.00
RC218129L4 Lenti ORF clone of Human secretin (SCT), mGFP tagged 10 ug
$450.00
SC304969 SCT (untagged)-Human secretin (SCT) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.