OST beta (SLC51B) (NM_178859) Human Tagged ORF Clone

SKU
RG217638
SLC51B (tGFP-tagged) - Human organic solute transporter beta (OSTBETA)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol OST beta
Synonyms OSTB; OSTBETA
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG217638 representing NM_178859
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCACAGTGAGGGGGCTCCCGGAGACCCAGCCGGTACTGTGGTACCCCAGGAGCTGCTGGAAGAGA
TGCTTTGGTTTTTTCGTGTGGAAGATGCATCTCCCTGGAATCATTCCATCCTTGCCCTGGCAGCTGTGGT
GGTCATTATAAGCATGGTCCTCCTGGGAAGAAGCATCCAGGCAAGCAGAAAAGAAAAGATGCAGCCACCA
GAAAAAGAAACTCCAGAAGTCCTGCATTTGGATGAGGCCAAGGATCACAACAGCCTAAACAACCTAAGAG
AAACTTTGCTCTCAGAAAAGCCAAACTTGGCCCAGGTGGAACTTGAGTTAAAAGAGAGAGATGTGCTGTC
AGTTTTCCTTCCGGATGTACCAGAAACTGAGAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG217638 representing NM_178859
Red=Cloning site Green=Tags(s)

MEHSEGAPGDPAGTVVPQELLEEMLWFFRVEDASPWNHSILALAAVVVIISMVLLGRSIQASRKEKMQPP
EKETPEVLHLDEAKDHNSLNNLRETLLSEKPNLAQVELELKERDVLSVFLPDVPETES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178859
ORF Size 384 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178859.4
RefSeq Size 454 bp
RefSeq ORF 387 bp
Locus ID 123264
UniProt ID Q86UW2
Cytogenetics 15q22.31
Protein Families Transmembrane
Summary Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. Efficiently transports the major species of bile acids. Modulates SLC51A glycosylation, membrane trafficking and stability activities.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:OST beta (SLC51B) (NM_178859) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217638 SLC51B (Myc-DDK-tagged)-Human organic solute transporter beta (OSTBETA) 10 ug
$225.00
RC217638L1 Lenti ORF clone of Human organic solute transporter beta (OSTBETA), Myc-DDK-tagged 10 ug
$525.00
RC217638L2 Lenti ORF clone of Human organic solute transporter beta (OSTBETA), mGFP tagged 10 ug
$525.00
RC217638L3 Lenti ORF clone of Human organic solute transporter beta (OSTBETA), Myc-DDK-tagged 10 ug
$525.00
RC217638L4 Lenti ORF clone of Human organic solute transporter beta (OSTBETA), mGFP tagged 10 ug
$525.00
SC307235 SLC51B (untagged)-Human organic solute transporter beta (OSTBETA) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.