FAM36A (COX20) (NM_198076) Human Tagged ORF Clone

SKU
RG217381
COX20 (tGFP-tagged) - Human family with sequence similarity 36, member A (FAM36A)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FAM36A
Synonyms FAM36A; MC4DN11
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG217381 representing NM_198076
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGCCCCGCCGGAGCCCGGTGAGCCCGAGGAGAGGAAGTCCCTTAAGCTCCTAGGATTTTTAGATG
TTGAAAATACTCCCTGCGCCCGGCATTCAATATTGTATGGTTCATTAGGATCTGTTGTGGCTGGCTTTGG
ACATTTTTTGTTCACTAGTAGAATTAGAAGATCATGTGATGTTGGAGTAGGAGGGTTTATCTTGGTGACT
TTGGGATGCTGGTTTCATTGTAGGTATAATTATGCAAAGCAAAGAATCCAGGAAAGAATTGCCAGAGAAG
AAATTAAAAAGAAGATATTATATGAAGGTACCCACCTCGATCCTGAAAGAAAACACAACGGCAGCAGCAG
CAAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG217381 representing NM_198076
Red=Cloning site Green=Tags(s)

MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVT
LGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_198076
ORF Size 354 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_198076.6
RefSeq Size 2632 bp
RefSeq ORF 357 bp
Locus ID 116228
UniProt ID Q5RI15
Cytogenetics 1q44
Summary This gene encodes a protein that plays a role in the assembly of cytochrome C oxidase, an important component of the respiratory pathway. It contains two transmembrane helices and localizes to the mitochondrial membrane. Mutations in this gene can cause mitochondrial complex IV deficiency, which results in ataxia and muscle hypotonia. There are multiple pseudogenes for this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
Write Your Own Review
You're reviewing:FAM36A (COX20) (NM_198076) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC217381 COX20 (Myc-DDK-tagged)-Human family with sequence similarity 36, member A (FAM36A) 10 ug
$150.00
RC217381L1 Lenti ORF clone of Human family with sequence similarity 36, member A (FAM36A), Myc-DDK-tagged 10 ug
$450.00
RC217381L2 Lenti ORF clone of Human family with sequence similarity 36, member A (FAM36A), mGFP tagged 10 ug
$450.00
RC217381L3 Lenti ORF clone of Human family with sequence similarity 36, member A (FAM36A), Myc-DDK-tagged 10 ug
$450.00
RC217381L4 Lenti ORF clone of Human family with sequence similarity 36, member A (FAM36A), mGFP tagged 10 ug
$450.00
SC126946 COX20 (untagged)-Human family with sequence similarity 36, member A (FAM36A) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.