ZNF706 (NM_001042510) Human Tagged ORF Clone

SKU
RG216962
ZNF706 (tGFP-tagged) - Human zinc finger protein 706 (ZNF706), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ZNF706
Synonyms HSPC038; PNAS-106; PNAS-113
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG216962 representing NM_001042510
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTCGTGGACAGCAGAAAATTCAGTCTCAGCAGAAAAATGCCAAAAAGCAAGCTGGACAAAAGAAGA
AACAAGGACATGACCAAAAGGCTGCTGCCAAAGCTGCCTTAATATATACCTGCACTGTCTGTAGGACACA
AATGCCAGACCCTAAGACCTTCAAGCAGCACTTTGAGAGCAAGCATCCTAAGACTCCACTTCCTCCAGAA
TTAGCTGATGTTCAGGCA


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG216962 representing NM_001042510
Red=Cloning site Green=Tags(s)

MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPE
LADVQA

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_001042510
ORF Size 228 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001042510.1, NP_001035975.1
RefSeq Size 2870 bp
RefSeq ORF 231 bp
Locus ID 51123
UniProt ID Q9Y5V0
Cytogenetics 8q22.3
Summary Transcription repressor involved in the exit of embryonic stem cells (ESCs) from self-renewal. Acts by repressing expression of KLF4.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:ZNF706 (NM_001042510) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216962 ZNF706 (Myc-DDK-tagged)-Human zinc finger protein 706 (ZNF706), transcript variant 1 10 ug
$150.00
RC216962L3 Lenti ORF clone of Human zinc finger protein 706 (ZNF706), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC216962L4 Lenti ORF clone of Human zinc finger protein 706 (ZNF706), transcript variant 1, mGFP tagged 10 ug
$450.00
SC311333 ZNF706 (untagged)-Human zinc finger protein 706 (ZNF706), transcript variant 1 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.