CTNNBIP1 (NM_020248) Human Tagged ORF Clone

SKU
RG216082
CTNNBIP1 (tGFP-tagged) - Human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CTNNBIP1
Synonyms ICAT
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG216082 representing NM_020248
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCGCGAGGGAGCTCCCGGGAAGAGTCCGGAGGAGATGTACATTCAGCAGAAGGTCCGAGTGCTGC
TCATGCTGCGGAAGATGGGATCAAACCTGACAGCCAGCGAGGAGGAGTTCCTGCGCACCTATGCAGGGGT
GGTCAACAGCCAGCTCAGCCAGCTGCCTCCGCACTCCATCGACCAGGGTGCAGAGGACGTGGTGATGGCG
TTTTCCAGGTCGGAGACGGAAGACCGGAGGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG216082 representing NM_020248
Red=Cloning site Green=Tags(s)

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA
FSRSETEDRRQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020248
ORF Size 243 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020248.3
RefSeq Size 2995 bp
RefSeq ORF 246 bp
Locus ID 56998
UniProt ID Q9NSA3
Cytogenetics 1p36.22
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Wnt signaling pathway
Summary The protein encoded by this gene binds CTNNB1 and prevents interaction between CTNNB1 and TCF family members. The encoded protein is a negative regulator of the Wnt signaling pathway. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:CTNNBIP1 (NM_020248) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC216082 CTNNBIP1 (Myc-DDK-tagged)-Human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1 10 ug
$150.00
RC216082L1 Lenti ORF clone of Human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC216082L2 Lenti ORF clone of Human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1, mGFP tagged 10 ug
$450.00
RC216082L3 Lenti ORF clone of Human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC216082L4 Lenti ORF clone of Human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1, mGFP tagged 10 ug
$450.00
SC113159 CTNNBIP1 (untagged)-Human catenin, beta interacting protein 1 (CTNNBIP1), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.