FGF22 (NM_020637) Human Tagged ORF Clone

SKU
RG215757
FGF22 (tGFP-tagged) - Human fibroblast growth factor 22 (FGF22)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FGF22
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG215757 representing NM_020637
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGCCGCCGCCTGTGGCTGGGCCTGGCCTGGCTGCTGCTGGCGCGGGCGCCGGACGCCGCGGGAACCC
CGAGCGCGTCGCGGGGACCGCGCAGCTACCCGCACCTGGAGGGCGACGTGCGCTGGCGGCGCCTCTTCTC
CTCCACTCACTTCTTCCTGCGCGTGGATCCCGGCGGCCGCGTGCAGGGCACCCGCTGGCGCCACGGCCAG
GACAGCATCCTGGAGATCCGCTCTGTACACGTGGGCGTCGTGGTCATCAAAGCAGTGTCCTCAGGCTTCT
ACGTGGCCATGAACCGCCGGGGCCGCCTCTACGGGTCGCGACTCTACACCGTGGACTGCAGGTTCCGGGA
GCGCATCGAAGAGAACGGCCACAACACCTACGCCTCACAGCGCTGGCGCCGCCGCGGCCAGCCCATGTTC
CTGGCGCTGGACAGGAGGGGGGGGCCCCGGCCAGGCGGCCGGACGCGGCGGTACCACCTGTCCGCCCACT
TCCTGCCCGTCCTGGTCTCC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG215757 representing NM_020637
Red=Cloning site Green=Tags(s)

MRRRLWLGLAWLLLARAPDAAGTPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQ
DSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMF
LALDRRGGPRPGGRTRRYHLSAHFLPVLVS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020637
ORF Size 510 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020637.2
RefSeq Size 513 bp
RefSeq ORF 513 bp
Locus ID 27006
UniProt ID Q9HCT0
Cytogenetics 19p13.3
Protein Families Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The mouse homolog of this gene was found to be preferentially expressed in the inner root sheath of the hair follicle, which suggested a role in hair development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
Write Your Own Review
You're reviewing:FGF22 (NM_020637) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215757 FGF22 (Myc-DDK-tagged)-Human fibroblast growth factor 22 (FGF22) 10 ug
$300.00
RC215757L1 Lenti ORF clone of Human fibroblast growth factor 22 (FGF22), Myc-DDK-tagged 10 ug
$600.00
RC215757L2 Lenti ORF clone of Human fibroblast growth factor 22 (FGF22), mGFP tagged 10 ug
$600.00
RC215757L3 Lenti ORF clone of Human fibroblast growth factor 22 (FGF22), Myc-DDK-tagged 10 ug
$600.00
RC215757L4 Lenti ORF clone of Human fibroblast growth factor 22 (FGF22), mGFP tagged 10 ug
$600.00
SC304788 FGF22 (untagged)-Human fibroblast growth factor 22 (FGF22) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.