Amylin (IAPP) (NM_000415) Human Tagged ORF Clone

SKU
RG215074
IAPP (tGFP-tagged) - Human islet amyloid polypeptide (IAPP)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Amylin
Synonyms DAP; IAP
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG215074 representing NM_000415
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCATCCTGAAGCTGCAAGTATTTCTCATTGTGCTCTCTGTTGCATTGAACCATCTGAAAGCTACAC
CCATTGAAAGTCATCAGGTGGAAAAGCGGAAATGCAACACTGCCACATGTGCAACGCAGCGCCTGGCAAA
TTTTTTAGTTCATTCCAGCAACAACTTTGGTGCCATTCTCTCATCTACCAACGTGGGATCCAATACATAT
GGCAAGAGGAATGCAGTAGAGGTTTTAAAGAGAGAGCCACTGAATTACTTGCCCCTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG215074 representing NM_000415
Red=Cloning site Green=Tags(s)

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY
GKRNAVEVLKREPLNYLPL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_000415
ORF Size 267 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000415.3
RefSeq Size 1462 bp
RefSeq ORF 270 bp
Locus ID 3375
UniProt ID P10997
Cytogenetics 12p12.1
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Maturity onset diabetes of the young
Summary This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity. [provided by RefSeq, Jul 2016]
Write Your Own Review
You're reviewing:Amylin (IAPP) (NM_000415) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215074 IAPP (Myc-DDK-tagged)-Human islet amyloid polypeptide (IAPP) 10 ug
$150.00
RC215074L1 Lenti ORF clone of Human islet amyloid polypeptide (IAPP), Myc-DDK-tagged 10 ug
$450.00
RC215074L2 Lenti ORF clone of Human islet amyloid polypeptide (IAPP), mGFP tagged 10 ug
$450.00
RC215074L3 Lenti ORF clone of Human islet amyloid polypeptide (IAPP), Myc-DDK-tagged 10 ug
$450.00
RC215074L4 Lenti ORF clone of Human islet amyloid polypeptide (IAPP), mGFP tagged 10 ug
$450.00
SC300065 IAPP (untagged)-Human islet amyloid polypeptide (IAPP) 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.