VKORC1 (NM_206824) Human Tagged ORF Clone

SKU
RG214831
VKORC1 (tGFP-tagged) - Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$425.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol VKORC1
Synonyms EDTP308; MST134; MST576; VKCFD2; VKOR
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG214831 representing NM_206824
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAGCACCTGGGGGAGCCCTGGCTGGGTGCGGCTCGCTCTTTGCCTGACGGGCTTAGTGCTCTCGC
TCTACGCGCTGCACGTGAAGGCGGCGCGCGCCCGGGACCGGGATTACCGCGCGCTCTGCGACGTGGGCAC
CGCCATCAGCTGTTCGCGCGTCTTCTCCTCCAGGTTGCCTGCGGACACGCTGGGCCTCTGTCCTGATGCT
GCTGAGCTCCCTGGTGTCTCTCGCTGGTTCTGTCTACCTGGCCTGGATCCTGTTCTTCGTGCTCTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG214831 representing NM_206824
Red=Cloning site Green=Tags(s)

MGSTWGSPGWVRLALCLTGLVLSLYALHVKAARARDRDYRALCDVGTAISCSRVFSSRLPADTLGLCPDA
AELPGVSRWFCLPGLDPVLRAL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_206824
ORF Size 276 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_206824.2
RefSeq Size 907 bp
RefSeq ORF 279 bp
Locus ID 79001
UniProt ID Q9BQB6
Cytogenetics 16p11.2
Protein Families Transmembrane
Summary This gene encodes the catalytic subunit of the vitamin K epoxide reductase complex, which is responsible for the reduction of inactive vitamin K 2,3-epoxide to active vitamin K in the endoplasmic reticulum membrane. Vitamin K is a required co-factor for carboxylation of glutamic acid residues by vitamin K-dependent gamma-carboxylase in blood-clotting enzymes. Allelic variation in this gene is associated with vitamin k-dependent clotting factors combined deficiency of 2, and increased resistance or sensitivity to warfarin, an inhibitor of vitamin K epoxide reductase. Pseudogenes of this gene are located on chromosomes 1 and X. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
Write Your Own Review
You're reviewing:VKORC1 (NM_206824) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214831 VKORC1 (Myc-DDK-tagged)-Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 2 10 ug
$225.00
RC214831L1 Lenti ORF clone of Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 2, Myc-DDK-tagged 10 ug
$525.00
RC214831L2 Lenti ORF clone of Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 2, mGFP tagged 10 ug
$525.00
RC214831L3 Lenti ORF clone of Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 2, Myc-DDK-tagged 10 ug
$525.00
RC214831L4 Lenti ORF clone of Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 2, mGFP tagged 10 ug
$525.00
SC308269 VKORC1 (untagged)-Human vitamin K epoxide reductase complex, subunit 1 (VKORC1), transcript variant 2 10 ug
$225.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.