FGF8 (NM_033163) Human Tagged ORF Clone

SKU
RG214516
FGF8 (tGFP-tagged) - Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant F
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol FGF8
Synonyms AIGF; FGF-8; HBGF-8; HH6; KAL6
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG214516 representing NM_033163
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCAGCCCCCGCTCCGCGCTGAGCTGCCTGCTGTTGCACTTGCTGGTCCTCTGCCTCCAAGCCCAGG
AAGGCCCGGGCAGGGGCCCTGCGCTGGGCAGGGAGCTCGCTTCCCTGTTCCGGGCTGGCCGGGAGCCCCA
GGGTGTCTCCCAACAGGTAACTGTTCAGTCCTCACCTAATTTTACACAGCATGTGAGGGAGCAGAGCCTG
GTGACGGATCAGCTCAGCCGCCGCCTCATCCGGACCTACCAACTCTACAGCCGCACCAGCGGGAAGCACG
TGCAGGTCCTGGCCAACAAGCGCATCAACGCCATGGCAGAGGACGGCGACCCCTTCGCAAAGCTCATCGT
GGAGACGGACACCTTTGGAAGCAGAGTCCGAGTCCGAGGAGCCGAGACGGGCCTCTACATCTGCATGAAC
AAGAAGGGGAAGCTGATCGCCAAGAGCAACGGCAAAGGCAAGGACTGCGTCTTCACGGAGATTGTGCTGG
AGAACAACTACACAGCGCTGCAGAATGCCAAGTACGAGGGCTGGTACATGGCCTTCACCCGCAAGGGCCG
GCCCCGCAAGGGCTCCAAGACGCGGCAGCACCAGCGTGAGGTCCACTTCATGAAGCGGCTGCCCCGGGGC
CACCACACCACCGAGCAGAGCCTGCGCTTCGAGTTCCTCAACTACCCGCCCTTCACGCGCAGCCTGCGCG
GCAGCCAGAGGACTTGGGCCCCCGAGCCCCGA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG214516 representing NM_033163
Red=Cloning site Green=Tags(s)

MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSL
VTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMN
KKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRG
HHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_033163
ORF Size 732 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033163.1, NP_149353.1
RefSeq Size 1107 bp
RefSeq ORF 735 bp
Locus ID 2253
UniProt ID P55075
Cytogenetics 10q24.32
Protein Families Druggable Genome, Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:FGF8 (NM_033163) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214516 FGF8 (Myc-DDK-tagged)-Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant F 10 ug
$300.00
RC214516L1 Lenti ORF clone of Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant F, Myc-DDK-tagged 10 ug
$600.00
RC214516L2 Lenti ORF clone of Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant F, mGFP tagged 10 ug
$600.00
RC214516L3 Lenti ORF clone of Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant F, Myc-DDK-tagged 10 ug
$600.00
RC214516L4 Lenti ORF clone of Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant F, mGFP tagged 10 ug
$600.00
SC305580 FGF8 (untagged)-Human fibroblast growth factor 8 (androgen-induced) (FGF8), transcript variant F 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.