Epigen (EPGN) (NM_001013442) Human Tagged ORF Clone

SKU
RG214501
EPGN (tGFP-tagged) - Human epithelial mitogen homolog (mouse) (EPGN)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Epigen
Synonyms ALGV3072; EPG; epigen; PRO9904
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG214501 representing NM_001013442
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTTGGGAGTTCCAATATCAGTCTATCTTTTATTCAACGCAATGACAGCACTGACCGAAGAGGCAG
CCGTGACTGTAACACCTCCAATCACAGCCCAGCAAGCTGACAACATAGAAGGACCCATAGCCTTGAAGTT
CTCACACCTTTGCCTGGAAGATCATAACAGTTACTGCATCAACGGTGCTTGTGCATTCCACCATGAGCTA
GAGAAAGCCATCTGCAGGTGTTTTACTGGTTATACTGGAGAAAGGTGTGAGCACTTGACTTTAACTTCAT
ATGCTGTGGATTCTTATGAAAAATACATTGCAATTGGGATTGGTGTTGGATTACTATTAAGTGGTTTTCT
TGTTATTTTTTACTGCTATATAAGAAAGAGGTATGAAAAAGACAAAATA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG214501 representing NM_001013442
Red=Cloning site Green=Tags(s)

MALGVPISVYLLFNAMTALTEEAAVTVTPPITAQQADNIEGPIALKFSHLCLEDHNSYCINGACAFHHEL
EKAICRCFTGYTGERCEHLTLTSYAVDSYEKYIAIGIGVGLLLSGFLVIFYCYIRKRYEKDKI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001013442
ORF Size 399 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001013442.1, NP_001013460.1
RefSeq Size 847 bp
RefSeq ORF 401 bp
Locus ID 255324
Cytogenetics 4q13.3
Protein Families Transmembrane
Summary The protein encoded by this gene is a member of the epidermal growth factor family. Members of this family are ligands for the epidermal growth factor receptor and play a role in cell survival, proliferation and migration. This protein has been reported to have high mitogenic activity but low affinity for its receptor. Expression of this transcript and protein have been reported in cancer specimens of the breast, bladder, and prostate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]
Write Your Own Review
You're reviewing:Epigen (EPGN) (NM_001013442) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214501 EPGN (Myc-DDK-tagged)-Human epithelial mitogen homolog (mouse) (EPGN) 10 ug
$150.00
RC214501L1 Lenti ORF clone of Human epithelial mitogen homolog (mouse) (EPGN), Myc-DDK-tagged 10 ug
$450.00
RC214501L2 Lenti ORF clone of Human epithelial mitogen homolog (mouse) (EPGN), mGFP tagged 10 ug
$450.00
RC214501L3 Lenti ORF clone of Human epithelial mitogen homolog (mouse) (EPGN), Myc-DDK-tagged 10 ug
$450.00
RC214501L4 Lenti ORF clone of Human epithelial mitogen homolog (mouse) (EPGN), mGFP tagged 10 ug
$450.00
SC301789 EPGN (untagged)-Human epithelial mitogen homolog (mouse) (EPGN) 10 ug
$165.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.