CDC42 (NM_001791) Human Tagged ORF Clone

SKU
RG214076
CDC42 (tGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00 MSRP $500.00 MSRP $500.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CDC42
Synonyms CDC42Hs; G25K; TKS
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG214076 representing NM_001791
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGACAATTAAGTGTGTTGTTGTGGGCGATGGTGCTGTTGGTAAAACATGTCTCCTGATATCCTACA
CAACAAACAAATTTCCATCGGAATATGTACCGACTGTTTTTGACAACTATGCAGTCACAGTTATGATTGG
TGGAGAACCATATACTCTTGGACTTTTTGATACTGCAGGGCAAGAGGATTATGACAGATTACGACCGCTG
AGTTATCCACAAACAGATGTATTTCTAGTCTGTTTTTCAGTGGTCTCTCCATCTTCATTTGAAAACGTGA
AAGAAAAGTGGGTGCCTGAGATAACTCACCACTGTCCAAAGACTCCTTTCTTGCTTGTTGGGACTCAAAT
TGATCTCAGAGATGACCCCTCTACTATTGAGAAACTTGCCAAGAACAAACAGAAGCCTATCACTCCAGAG
ACTGCTGAAAAGCTGGCCCGTGACCTGAAGGCTGTCAAGTATGTGGAGTGTTCTGCACTTACACAGAAAG
GCCTAAAGAATGTATTTGACGAAGCAATATTGGCTGCCCTGGAGCCTCCAGAACCGAAGAAGAGCCGCAG
GTGTGTGCTGCTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG214076 representing NM_001791
Red=Cloning site Green=Tags(s)

MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPL
SYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPE
TAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001791
ORF Size 573 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001791.4
RefSeq Size 2183 bp
RefSeq ORF 576 bp
Locus ID 998
UniProt ID P60953
Cytogenetics 1p36.12
Domains RAB, ras, RAS, RHO
Protein Families Druggable Genome
Protein Pathways Adherens junction, Axon guidance, Chemokine signaling pathway, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, Fc gamma R-mediated phagocytosis, Focal adhesion, GnRH signaling pathway, Leukocyte transendothelial migration, MAPK signaling pathway, Neurotrophin signaling pathway, Pancreatic cancer, Pathogenic Escherichia coli infection, Pathways in cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Tight junction, VEGF signaling pathway
Summary The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. Pseudogenes of this gene have been identified on chromosomes 3, 4, 5, 7, 8 and 20. [provided by RefSeq, Apr 2013]
Write Your Own Review
You're reviewing:CDC42 (NM_001791) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214076 CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1 10 ug
$300.00
RC214076L1 Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC214076L2 Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, mGFP tagged 10 ug
$600.00
RC214076L3 Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC214076L4 Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, mGFP tagged 10 ug
$600.00
SC109055 CDC42 (untagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.