YY1 associated factor 2 (YAF2) (NM_005748) Human Tagged ORF Clone

SKU
RG214071
YAF2 (tGFP-tagged) - Human YY1 associated factor 2 (YAF2), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol YY1 associated factor 2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG214071 representing NM_005748
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGAGACAAGAAGAGCCCCACCAGGCCGAAGCGGCAGCCGAAGCCGTCCTCGGATGAGGGTTACTGGG
ACTGTAGCGTCTGCACCTTCCGGAACAGCGCCGAGGCCTTCAAGTGCATGATGTGCGATGTGCGGAAGGG
CACCTCCACCCGGAAACCTCGACCTGTCTCCCAGTTGGTTGCACAGCAGGTTACTCAGCAGTTTGTGCCT
CCTACACAGTCAAAGAAAGAGAAAAAAGATAAAGTAGAAAAAGAAAAAAGTGAAAAGGAAACAACTAGCA
AAAAGAATAGCCATAAGAAAACCAGGCCAAGATTGAAAAATGTGGATCGGAGTAGTGCTCAGCATTTGGA
AGTTACTGTTGGAGATCTGACAGTCATTATTACAGACTTTAAGGAGAAAACAAAGTCACCGCCTGCATCT
AGTGCTGCTTCTGCAGATCAACACAGTCAAAGCGGCTCTAGCTCTGATAACACAGAGAGAGGAATGTCCA
GGTCATCTTCACCCAGAGGAGAAGCCTCATCATTGAATGGAGAATCTCAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG214071 representing NM_005748
Red=Cloning site Green=Tags(s)

MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVP
PTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPAS
SAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_005748
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005748.6
RefSeq Size 4096 bp
RefSeq ORF 543 bp
Locus ID 10138
UniProt ID Q8IY57
Cytogenetics 12q12
Domains zf-RanBP
Protein Families Druggable Genome, Transcription Factors
Summary This gene encodes a zinc finger containing protein that functions in the regulation of transcription. This protein was identified as an interacting partner of transcriptional repressor protein Yy1, and also interacts with other transcriptional regulators, including Myc and Polycomb. This protein can promote proteolysis of Yy1. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Feb 2016]
Write Your Own Review
You're reviewing:YY1 associated factor 2 (YAF2) (NM_005748) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC214071 YAF2 (Myc-DDK-tagged)-Human YY1 associated factor 2 (YAF2), transcript variant 2 10 ug
$300.00
RC214071L1 Lenti ORF clone of Human YY1 associated factor 2 (YAF2), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC214071L2 Lenti ORF clone of Human YY1 associated factor 2 (YAF2), transcript variant 2, mGFP tagged 10 ug
$600.00
RC214071L3 Lenti ORF clone of Human YY1 associated factor 2 (YAF2), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC214071L4 Lenti ORF clone of Human YY1 associated factor 2 (YAF2), transcript variant 2, mGFP tagged 10 ug
$600.00
SC315481 YAF2 (untagged)-Human YY1 associated factor 2 (YAF2), transcript variant 2 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.