HOXB9 (NM_024017) Human Tagged ORF Clone

SKU
RG213735
HOXB9 (tGFP-tagged) - Human homeobox B9 (HOXB9)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$650.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HOXB9
Synonyms HOX-2.5; HOX2; HOX2E
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG213735 representing NM_024017
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCATTTCTGGGACGCTTAGCAGCTATTATGTCGACTCGATCATAAGTCACGAGAGTGAGGACGCGC
CTCCAGCCAAGTTTCCTTCTGGCCAGTACGCGAGCTCGCGGCAGCCGGGCCACGCGGAGCACCTGGAGTT
CCCCTCGTGCAGCTTCCAGCCCAAAGCGCCGGTGTTCGGCGCCTCCTGGGCGCCGCTGAGCCCGCACGCG
TCCGGGAGCCTGCCGTCCGTCTACCACCCTTACATCCAGCCCCAGGGCGTCCCGCCGGCCGAGAGCAGGT
ACCTCCGCACCTGGCTGGAGCCGGCGCCGCGCGGCGAAGCGGCCCCGGGGCAGGGCCAGGCGGCGGTGAA
GGCGGAGCCGCTGCTGGGCGCGCCTGGGGAGCTGCTCAAACAGGGCACGCCCGAGTACAGTTTGGAAACT
TCGGCGGGCAGGGAGGCCGTGCTGTCTAATCAAAGACCCGGCTACGGGGACAATAAAATTTGCGAAGGAA
GCGAGGACAAAGAGAGGCCGGATCAAACCAACCCCTCCGCCAACTGGCTGCACGCTCGCTCTTCCCGGAA
AAAGCGCTGTCCCTACACCAAATACCAGACGCTGGAGCTAGAGAAGGAGTTTCTGTTCAATATGTACCTC
ACCAGGGACCGTAGGCACGAAGTGGCCAGACTCCTCAATCTGAGTGAGAGACAAGTCAAAATCTGGTTTC
AGAACCGGCGGATGAAAATGAAGAAAATGAATAAGGAGCAGGGCAAAGAG


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG213735 representing NM_024017
Red=Cloning site Green=Tags(s)

MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYASSRQPGHAEHLEFPSCSFQPKAPVFGASWAPLSPHA
SGSLPSVYHPYIQPQGVPPAESRYLRTWLEPAPRGEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLET
SAGREAVLSNQRPGYGDNKICEGSEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYL
TRDRRHEVARLLNLSERQVKIWFQNRRMKMKKMNKEQGKE

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_024017
ORF Size 750 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024017.5
RefSeq Size 2583 bp
RefSeq ORF 753 bp
Locus ID 3219
UniProt ID P17482
Cytogenetics 17q21.32
Protein Families Transcription Factors
Summary This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of leukemia, prostate cancer and lung cancer. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HOXB9 (NM_024017) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213735 HOXB9 (Myc-DDK-tagged)-Human homeobox B9 (HOXB9) 10 ug
$450.00
RC213735L1 Lenti ORF clone of Human homeobox B9 (HOXB9), Myc-DDK-tagged 10 ug
$750.00
RC213735L2 Lenti ORF clone of Human homeobox B9 (HOXB9), mGFP tagged 10 ug
$750.00
RC213735L3 Lenti ORF clone of Human homeobox B9 (HOXB9), Myc-DDK-tagged 10 ug
$750.00
RC213735L4 Lenti ORF clone of Human homeobox B9 (HOXB9), mGFP tagged 10 ug
$750.00
SC122943 HOXB9 (untagged)-Human homeobox B9 (HOXB9) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.