UQCRQ (NM_014402) Human Tagged ORF Clone

SKU
RG213638
UQCRQ (tGFP-tagged) - Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UQCRQ
Synonyms MC3DN4; QCR8; QP-C; QPC; UQCR7
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG213638 representing NM_014402
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCGCGAGTTTGGGAATCTGACGCGGATGCGGCATGTGATCAGCTACAGCTTGTCACCGTTCGAGC
AGCGCGCCTATCCGCACGTCTTCACTAAAGGAATCCCCAATGTTCTGCGCCGCATTCGGGAGTCTTTCTT
TCGCGTGGTGCCGCAGTTTGTAGTGTTTTATCTTATCTACACATGGGGGACTGAAGAGTTCGAGAGATCC
AAGAGGAGGATCCAGCTGCCTATGAAAATGACAAATGAGCAACGCATCCGGATGACGGTTCCCTGTCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG213638 representing NM_014402
Red=Cloning site Green=Tags(s)

MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERS
KRRIQLPMKMTNEQRIRMTVPCL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_014402
ORF Size 279 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014402.2, NP_055217.1
RefSeq Size 388 bp
RefSeq ORF 249 bp
Locus ID 27089
UniProt ID O14949
Cytogenetics 5q31.1
Domains UcrQ
Protein Pathways Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease
Summary This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:UQCRQ (NM_014402) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213638 UQCRQ (Myc-DDK-tagged)-Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein 10 ug
$150.00
RC213638L3 Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$450.00
RC213638L4 Lenti ORF clone of Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$450.00
SC115007 UQCRQ (untagged)-Human ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa (UQCRQ), nuclear gene encoding mitochondrial protein 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.