HMGA1 (NM_145902) Human Tagged ORF Clone

SKU
RG213109
HMGA1 (tGFP-tagged) - Human high mobility group AT-hook 1 (HMGA1), transcript variant 4
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HMGA1
Synonyms HMG-R; HMGA1A; HMGIY
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG213109 representing NM_145902
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGAGTCGAGCTCGAAGTCCAGCCAGCCCTTGGCCTCCAAGCAGGAAAAGGACGGCACTGAGAAGC
GGGGCCGGGGCAGGCCGCGCAAGCAGCCTCCGAAGGAGCCCAGCGAAGTGCCAACACCTAAGAGACCTCG
GGGCCGACCAAAGGGAAGCAAAAACAAGGGTGCTGCCAAGACCCGGAAAACCACCACAACTCCAGGAAGG
AAACCAAGGGGCAGACCCAAAAAACTGGAGAAGGAGGAAGAGGAGGGCATCTCGCAGGAGTCCTCGGAGG
AGGAGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG213109 representing NM_145902
Red=Cloning site Green=Tags(s)

MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGR
KPRGRPKKLEKEEEEGISQESSEEEQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145902
ORF Size 288 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145902.3
RefSeq Size 1843 bp
RefSeq ORF 291 bp
Locus ID 3159
UniProt ID P17096
Cytogenetics 6p21.31
Protein Families Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors
Summary This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. [provided by RefSeq, Jan 2016]
Write Your Own Review
You're reviewing:HMGA1 (NM_145902) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213109 HMGA1 (Myc-DDK-tagged)-Human high mobility group AT-hook 1 (HMGA1), transcript variant 4 10 ug
$150.00
RC213109L3 Lenti ORF clone of Human high mobility group AT-hook 1 (HMGA1), transcript variant 4, Myc-DDK-tagged 10 ug
$450.00
RC213109L4 Lenti ORF clone of Human high mobility group AT-hook 1 (HMGA1), transcript variant 4, mGFP tagged 10 ug
$450.00
SC109301 HMGA1 (untagged)-Human high mobility group AT-hook 1 (HMGA1), transcript variant 4 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.