HLAF (HLA-F) (NM_001098478) Human Tagged ORF Clone

SKU
RG213005
HLA (tGFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$680.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HLAF
Synonyms CDA12; HLA-5.4; HLA-CDA12; HLAF
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG213005 representing NM_001098478
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCCCCGAAGCCTCCTCCTGCTGCTCTCAGGGGCCCTGGCCCTGACCGATACTTGGGCGGGCTCCC
ACTCCTTGAGGTATTTCAGCACCGCTGTGTCGCGGCCCGGCCGCGGGGAGCCCCGCTACATCGCCGTGGA
GTACGTAGACGACACGCAATTCCTGCGGTTCGACAGCGACGCCGCGATTCCGAGGATGGAGCCGCGGGAG
CCGTGGGTGGAGCAAGAGGGGCCGCAGTATTGGGAGTGGACCACAGGGTACGCCAAGGCCAACGCACAGA
CTGACCGAGTGGCCCTGAGGAACCTGCTCCGCCGCTACAACCAGAGCGAGGCTGGGTCTCACACCCTCCA
GGGAATGAATGGCTGCGACATGGGGCCCGACGGACGCCTCCTCCGCGGGTATCACCAGCACGCGTACGAC
GGCAAGGATTACATCTCCCTGAACGAGGACCTGCGCTCCTGGACCGCGGCGGACACCGTGGCTCAGATCA
CCCAGCGCTTCTATGAGGCAGAGGAATATGCAGAGGAGTTCAGGACCTACCTGGAGGGCGAGTGCCTGGA
GTTGCTCCGCAGATACTTGGAGAATGGGAAGGAGACGCTACAGCGCGCAGAGCAGTCTCCCCAGCCCACC
ATCCCCATCGTGGGCATCGTTGCTGGCCTTGTTGTCCTTGGAGCTGTGGTCACTGGAGCTGTGGTCGCTG
CTGTGATGTGGAGGAAGAAGAGCTCAGATAGAAACAGAGGGAGCTACTCTCAGGCTGCAGTG


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG213005 representing NM_001098478
Red=Cloning site Green=Tags(s)

MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSDAAIPRMEPRE
PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMNGCDMGPDGRLLRGYHQHAYD
GKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTYLEGECLELLRRYLENGKETLQRAEQSPQPT
IPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_001098478
ORF Size 762 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001098478.2
RefSeq Size 1025 bp
RefSeq ORF 765 bp
Locus ID 3134
UniProt ID P30511
Cytogenetics 6p22.1
Protein Families Transmembrane
Protein Pathways Allograft rejection, Antigen processing and presentation, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Endocytosis, Graft-versus-host disease, Type I diabetes mellitus, Viral myocarditis
Summary This gene belongs to the HLA class I heavy chain paralogues. It encodes a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene exhibits few polymorphisms. Multiple transcript variants encoding different isoforms have been found for this gene. These variants lack a coding exon found in transcripts from other HLA paralogues due to an altered splice acceptor site, resulting in a shorter cytoplasmic domain. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:HLAF (HLA-F) (NM_001098478) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC213005 HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3 10 ug
$480.00
RC213005L3 Lenti-ORF clone of HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3 10 ug
$780.00
RC213005L4 Lenti-ORF clone of HLA (mGFP-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3 10 ug
$780.00
SC316351 HLA (untagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3 10 ug
$480.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.